HNRPGT Antibody, Novus Biologicals™
Manufacturer: Novus Biologicals
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP192000-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP192000 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
HNRPGT
Classification
Polyclonal
Dilution
Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias
hnRNP G-T, HNRNPG-T, HNRNPGTRNA-binding motif protein, X-linked-like-2, HNRPGTheterogeneous nuclear ribonucleoprotein G T, RNA binding motif protein, X-linked-like 2, testes specific heterogenous nuclear ribonucleoprotein G T, testes-specific heterogenous nuclear ribonucleoprotein G-T, Testis-specific heterogeneous nuclear ribonucleoprotein G-T
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Gene ID (Entrez)
27288
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols
RBMXL2
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:GGRDRDYGDHLSRGSHREPFESYGEL
Quantity
0.1 mL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- HNRPGT Polyclonal specifically detects HNRPGT in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: HNRPGT
Classification: Polyclonal
Dilution: Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin 1:50 - 1:200
Gene Alias: hnRNP G-T, HNRNPG-T, HNRNPGTRNA-binding motif protein, X-linked-like-2, HNRPGTheterogeneous nuclear ribonucleoprotein G T, RNA binding motif protein, X-linked-like 2, testes specific heterogenous nuclear ribonucleoprotein G T, testes-specific heterogenous nuclear ribonucleoprotein G-T, Testis-specific heterogeneous nuclear ribonucleoprotein G-T
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 27288
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: RBMXL2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GGRDRDYGDHLSRGSHREPFESYGEL
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Gene ID (Entrez): 27288
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Symbols: __
Immunogen: GGRDRDYGDHLSRGSHREPFESYGEL
Quantity: 0.1mL
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: HNRNPUL2
Classification: Polyclonal
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Alias: DKFZp762N1910, heterogeneous nuclear ribonucleoprotein U-like 2, heterogeneous nuclear ribonucleoprotein U-like protein 2, HNRPUL2, SAF-A2, Scaffold-attachment factor A2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Gene ID (Entrez): 221092
Target Species: Human
Isotype: IgG
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Symbols: HNRNPUL2
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LPGSGKTQWALKYAKENPEKRYNVLGAETVLNQMRMKGLEEPEMDPKSRDLLVQQASQCLSKLVQIASRTKRNFIL
Quantity: 0.1 mL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.