IMP2/IGF2BP2 Antibody, Novus Biologicals™
Manufacturer: Fischer Scientific
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP233992-Each-of-1 | In Stock | ₹ 53,688.90 |
NBP233992 - Each of 1
In Stock
Quantity
1
Base Price: ₹ 53,688.90
GST (18%): ₹ 9,664.002
Total Price: ₹ 63,352.902
Antigen
IMP2/IGF2BP2
Classification
Polyclonal
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.
Q9Y6M1
Gene Symbols
IGF2BP2
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: ITVKGTVEACASAEIEIMKKLREAFENDMLAVNTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAV
Quantity
0.1 mL
Research Discipline
Cancer, Chromatin Research, Immune System Diseases, Immunology, Transcription Factors and Regulators
Gene ID (Entrez)
10644
Target Species
Human
Isotype
IgG
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
Hepatocellular carcinoma autoantigen p62, IGF-II mRNA-binding protein 2, IMP-2IGF2 mRNA-binding protein 2, IMP2VICKZ family member 2, insulin-like growth factor 2 mRNA binding protein 2, insulin-like growth factor 2 mRNA-binding protein 2, p62, VICKZ2
Host Species
Rabbit
Purification Method
Affinity Purified
Regulatory Status
RUO
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- IMP2/IGF2BP2 Polyclonal specifically detects IMP2/IGF2BP2 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: IMP2/IGF2BP2
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: Q9Y6M1
Gene Symbols: IGF2BP2
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: ITVKGTVEACASAEIEIMKKLREAFENDMLAVNTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAV
Quantity: 0.1 mL
Research Discipline: Cancer, Chromatin Research, Immune System Diseases, Immunology, Transcription Factors and Regulators
Gene ID (Entrez): 10644
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Hepatocellular carcinoma autoantigen p62, IGF-II mRNA-binding protein 2, IMP-2IGF2 mRNA-binding protein 2, IMP2VICKZ family member 2, insulin-like growth factor 2 mRNA binding protein 2, insulin-like growth factor 2 mRNA-binding protein 2, p62, VICKZ2
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: __
Classification: __
Dilution: __
Gene Accession No.: __
Gene Symbols: __
Immunogen: ITVKGTVEACASAEIEIMKKLREAFENDMLAVNTHSGYFSSLYPHHQFGPFPHHHSYPEQEIVNLFIPTQAV
Quantity: 0.1mL
Research Discipline: __
Gene ID (Entrez): 10644
Target Species: __
Isotype: __
Applications: __
Conjugate: __
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: __
Host Species: __
Purification Method: Chromatography
Regulatory Status: RUO
Primary or Secondary: __
Test Specificity: __
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: RABL3
Classification: Polyclonal
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:20 - 1:50
Gene Accession No.: Q5HYI8
Gene Symbols: RABL3
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: KSSLVHLLCQNQVLGNPSWTVGCSVDVRVHDYKEGTPEEKTYYIELWDVGGSVGSASSVKSTRAVFYNSVNGIIFVHD
Quantity: 0.1 mL
Research Discipline: Signal Transduction
Gene ID (Entrez): 285282
Target Species: Human
Isotype: IgG
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: MGC23920, RAB, member of RAS oncogene family-like 3, rab-like protein 3
Host Species: Rabbit
Purification Method: Affinity Purified
Regulatory Status: RUO
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.