NBP256580PE
Novus Biologicals™ BATF Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP256580PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP256580PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
10538
Common Name
BATF Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
basic leucine zipper transcription factor, ATF-like, BATF1basic leucine zipper transcriptional factor ATF-like, B-ATFSFA2, B-cell-activating transcription factor, SFA-2activating transcription factor B, SF-HT-activated gene 2 protein
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
BATF
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52365. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BATF
- Source: E.coli Amino Acid Sequence: DSSDSSFSRSPPPGKQDSSDDVRRVQRREK The BATF Recombinant Protein Antigen is derived from E
- coli
- The BATF Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 10538
Common Name: BATF Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: basic leucine zipper transcription factor, ATF-like, BATF1basic leucine zipper transcriptional factor ATF-like, B-ATFSFA2, B-cell-activating transcription factor, SFA-2activating transcription factor B, SF-HT-activated gene 2 protein
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: BATF
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52365. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
10538
Common Name:
BATF Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
basic leucine zipper transcription factor, ATF-like, BATF1basic leucine zipper transcriptional factor ATF-like, B-ATFSFA2, B-cell-activating transcription factor, SFA-2activating transcription factor B, SF-HT-activated gene 2 protein
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
BATF
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52365. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 23637
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DKFZp586D2123, GAP and centrosome-associated protein, GAPCENA, RAB GTPase activating protein 1, rab GTPase-activating protein 1, rab6 GTPase activating protein (GAP and centrosome-associated), Rab6 GTPase activating protein, GAPCenA, Rab6 GTPase-activating protein GAPCenA, RP11-123N4.2, TBC1 domain family, member 11, TBC1D11
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
23637
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DKFZp586D2123, GAP and centrosome-associated protein, GAPCENA, RAB GTPase activating protein 1, rab GTPase-activating protein 1, rab6 GTPase activating protein (GAP and centrosome-associated), Rab6 GTPase activating protein, GAPCenA, Rab6 GTPase-activating protein GAPCenA, RP11-123N4.2, TBC1 domain family, member 11, TBC1D11
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 23637
Common Name: RABGAP1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: DKFZp586D2123, GAP and centrosome-associated protein, GAPCENA, RAB GTPase activating protein 1, rab GTPase-activating protein 1, rab6 GTPase activating protein (GAP and centrosome-associated), Rab6 GTPase activating protein, GAPCenA, Rab6 GTPase-activatin
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RABGAP1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50890. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
23637
Common Name:
RABGAP1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
DKFZp586D2123, GAP and centrosome-associated protein, GAPCENA, RAB GTPase activating protein 1, rab GTPase-activating protein 1, rab6 GTPase activating protein (GAP and centrosome-associated), Rab6 GTPase activating protein, GAPCenA, Rab6 GTPase-activatin
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RABGAP1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50890. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 54212
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: G1SYNsyntrophin-4, gamma-1-syntrophin, gamma1-syntrophin, SYN4syntrophin 4, syntrophin, gamma 1, Syntrophin-4
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
54212
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
G1SYNsyntrophin-4, gamma-1-syntrophin, gamma1-syntrophin, SYN4syntrophin 4, syntrophin, gamma 1, Syntrophin-4
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__