NBP257620PE
Novus Biologicals™ Annexin A7 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP257620PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP257620PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
310
Common Name
Annexin A7 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4
Gene Alias
annexin A7, ANX7, ANXA7, SNX, SYNEXIN
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ANXA7
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50612. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human Annexin A7
- Source: E.coli Amino Acid Sequence: TGYPPFPGYPPAGQESSFPPSGQYPYPSGFPPMGGGAYPQVPSSGYPGAGGYPAP The Annexin A7 Recombinant Protein Antigen is derived from E
- coli
- The Annexin A7 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 310
Common Name: Annexin A7 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: annexin A7, ANX7, ANXA7, SNX, SYNEXIN
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ANXA7
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50612. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
310
Common Name:
Annexin A7 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
annexin A7, ANX7, ANXA7, SNX, SYNEXIN
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ANXA7
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50612. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 5705
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: MSUG1 protein, p45, p45/SUG26S protease regulatory subunit 8, proteasome (prosome, macropain) 26S subunit, ATPase, 5, proteasome 26S ATPase subunit 5, Proteasome 26S subunit ATPase 5, Proteasome subunit p45, S8, SUG-1, SUG126S proteasome AAA-ATPase subunit RPT6, Tat-binding protein homolog 10, TBP10, thyroid receptor interactor 1, TRIP1Thyroid hormone receptor-interacting protein 1
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
5705
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
MSUG1 protein, p45, p45/SUG26S protease regulatory subunit 8, proteasome (prosome, macropain) 26S subunit, ATPase, 5, proteasome 26S ATPase subunit 5, Proteasome 26S subunit ATPase 5, Proteasome subunit p45, S8, SUG-1, SUG126S proteasome AAA-ATPase subunit RPT6, Tat-binding protein homolog 10, TBP10, thyroid receptor interactor 1, TRIP1Thyroid hormone receptor-interacting protein 1
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 5705
Common Name: SUG1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: MSUG1 protein, p45, p45/SUG26S protease regulatory subunit 8, proteasome (prosome, macropain) 26S subunit, ATPase, 5, proteasome 26S ATPase subunit 5, Proteasome 26S subunit ATPase 5, Proteasome subunit p45, S8, SUG-1, SUG126S proteasome AAA-ATPase subuni
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PSMC5
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50613. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
5705
Common Name:
SUG1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
MSUG1 protein, p45, p45/SUG26S protease regulatory subunit 8, proteasome (prosome, macropain) 26S subunit, ATPase, 5, proteasome 26S ATPase subunit 5, Proteasome 26S subunit ATPase 5, Proteasome subunit p45, S8, SUG-1, SUG126S proteasome AAA-ATPase subuni
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PSMC5
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50613. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 3170
Common Name: HNF-3 beta/FoxA2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4
Gene Alias: forkhead box A2, Forkhead box protein A2, hepatic nuclear factor-3-beta, hepatocyte nuclear factor 3, beta, hepatocyte nuclear factor 3-beta, HNF-3B, HNF-3-beta, HNF3BTCF-3B, MGC19807, TCF3B, Transcription factor 3B
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FOXA2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52975. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
3170
Common Name:
HNF-3 beta/FoxA2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4
Gene Alias:
forkhead box A2, Forkhead box protein A2, hepatic nuclear factor-3-beta, hepatocyte nuclear factor 3, beta, hepatocyte nuclear factor 3-beta, HNF-3B, HNF-3-beta, HNF3BTCF-3B, MGC19807, TCF3B, Transcription factor 3B
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FOXA2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52975. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml