NBP258040PE
Novus Biologicals™ BTG4 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258040PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258040PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
54766
Common Name
BTG4 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
B-cell translocation gene 4, BTG family member 4, MGC33003, PC3BProtein PC3b, protein BTG4
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
BTG4
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52150. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human BTG4
- Source: E.coli Amino Acid Sequence: GQAFRCIRINNNQNKDPILERACVESNVDFSHLGLPKEMTIWVDPFE The BTG4 Recombinant Protein Antigen is derived from E
- coli
- The BTG4 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 54766
Common Name: BTG4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: B-cell translocation gene 4, BTG family member 4, MGC33003, PC3BProtein PC3b, protein BTG4
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: BTG4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52150. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
54766
Common Name:
BTG4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
B-cell translocation gene 4, BTG family member 4, MGC33003, PC3BProtein PC3b, protein BTG4
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
BTG4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52150. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 6624
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: FAN1,55 kDa actin-bundling protein, fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus), FLJ38511, HSN, p55actin bundling protein, singed (Drosophila)-like (sea urchin fascin homolog like), singed-like (fascin homolog, sea urchin), Singed-like protein, SNLfascin
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
6624
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
FAN1,55 kDa actin-bundling protein, fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus), FLJ38511, HSN, p55actin bundling protein, singed (Drosophila)-like (sea urchin fascin homolog like), singed-like (fascin homolog, sea urchin), Singed-like protein, SNLfascin
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 6624
Common Name: Fascin Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: FAN1,55 kDa actin-bundling protein, fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus), FLJ38511, HSN, p55actin bundling protein, singed (Drosophila)-like (sea urchin fascin homolog like), singed-like (fascin homolog, sea urchin), Si
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FSCN1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51688. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6624
Common Name:
Fascin Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
FAN1,55 kDa actin-bundling protein, fascin homolog 1, actin-bundling protein (Strongylocentrotus purpuratus), FLJ38511, HSN, p55actin bundling protein, singed (Drosophila)-like (sea urchin fascin homolog like), singed-like (fascin homolog, sea urchin), Si
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FSCN1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51688. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 55872
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: Cancer/testis antigen 84, CT84MAPKK-like protein kinase, EC 2.7.12.2, FLJ14385, Nori-3PDZ-binding kinase, PDZ binding kinase, serine/threonine protein kinase, Spermatogenesis-related protein kinase, SPKT-LAK cell-originated protein kinase, TOPKlymphokine-activated killer T-cell-originated protein kinase
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
55872
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
Cancer/testis antigen 84, CT84MAPKK-like protein kinase, EC 2.7.12.2, FLJ14385, Nori-3PDZ-binding kinase, PDZ binding kinase, serine/threonine protein kinase, Spermatogenesis-related protein kinase, SPKT-LAK cell-originated protein kinase, TOPKlymphokine-activated killer T-cell-originated protein kinase
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__