NBP258518PE
Novus Biologicals™ PGPEP-1 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258518PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258518PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
54858
Common Name
PGPEP-1 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
EC 3.4.19.3, Pcp, PGPIFLJ20208, PGP-IPAP-I, PGPMGC10812, Pyroglutamyl aminopeptidase I, pyroglutamyl-peptidase 1, pyroglutamyl-peptidase I5-oxoprolyl-peptidase, Pyrrolidone-carboxylate peptidase
Label Type
Unlabeled
Quantity
100μL
Research Category
Proteases & Other Enzymes
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52007. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
PGPEP1
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Source
E.Coli
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human PGPEP-1
- Source: E.coli Amino Acid Sequence: MEQPRKAVVVTGFGPFGEHTVNASWIAVQELEKLGLGDSVDLHVYEIPVEYQTVQRLIPALWEKHS The PGPEP-1 Recombinant Protein Antigen is derived from E
- coli
- The PGPEP-1 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 54858
Common Name: PGPEP-1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 3.4.19.3, Pcp, PGPIFLJ20208, PGP-IPAP-I, PGPMGC10812, Pyroglutamyl aminopeptidase I, pyroglutamyl-peptidase 1, pyroglutamyl-peptidase I5-oxoprolyl-peptidase, Pyrrolidone-carboxylate peptidase
Label Type: Unlabeled
Quantity: 100μL
Research Category: Proteases & Other Enzymes
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52007. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: PGPEP1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.Coli
Gene ID (Entrez):
54858
Common Name:
PGPEP-1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 3.4.19.3, Pcp, PGPIFLJ20208, PGP-IPAP-I, PGPMGC10812, Pyroglutamyl aminopeptidase I, pyroglutamyl-peptidase 1, pyroglutamyl-peptidase I5-oxoprolyl-peptidase, Pyrrolidone-carboxylate peptidase
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
Proteases & Other Enzymes
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52007. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
PGPEP1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.Coli
Gene ID (Entrez): 9783
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: KIAA0137, KIAA0237, Nim3, NIM3Rab-3 interacting molecule 3, Rab-3-interacting molecule 3, regulating synaptic membrane exocytosis 3, regulating synaptic membrane exocytosis protein 3, RIM 3, RIM3, RIM3 gamma
Label Type: __
Quantity: 100 μL
Research Category: __
Specific Reactivity: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Source: __
Gene ID (Entrez):
9783
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
KIAA0137, KIAA0237, Nim3, NIM3Rab-3 interacting molecule 3, Rab-3-interacting molecule 3, regulating synaptic membrane exocytosis 3, regulating synaptic membrane exocytosis protein 3, RIM 3, RIM3, RIM3 gamma
Label Type:
__
Quantity:
100 μL
Research Category:
__
Specific Reactivity:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Source:
__
Gene ID (Entrez): 9783
Common Name: RIMS3 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: KIAA0137, KIAA0237, Nim3, NIM3Rab-3 interacting molecule 3, Rab-3-interacting molecule 3, regulating synaptic membrane exocytosis 3, regulating synaptic membrane exocytosis protein 3, RIM 3, RIM3, RIM3 gamma
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52008. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: RIMS3
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.Coli
Gene ID (Entrez):
9783
Common Name:
RIMS3 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
KIAA0137, KIAA0237, Nim3, NIM3Rab-3 interacting molecule 3, Rab-3-interacting molecule 3, regulating synaptic membrane exocytosis 3, regulating synaptic membrane exocytosis protein 3, RIM 3, RIM3, RIM3 gamma
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52008. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
RIMS3
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.Coli
Gene ID (Entrez): 8789
Common Name: FBP2 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: D-fructose-1,6-bisphosphate 1-phosphohydrolase 2, EC 3.1.3, EC 3.1.3.11, FBPase 2, fructose-1,6-bisphosphatase 2, fructose-1,6-bisphosphatase isozyme 2, hexosediphosphatase, MGC142192, muscle fructose-bisphosphatase
Label Type: Unlabeled
Quantity: 100μL
Research Category: __
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52009. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: FBP2
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Source: E.Coli
Gene ID (Entrez):
8789
Common Name:
FBP2 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
D-fructose-1,6-bisphosphate 1-phosphohydrolase 2, EC 3.1.3, EC 3.1.3.11, FBPase 2, fructose-1,6-bisphosphatase 2, fructose-1,6-bisphosphatase isozyme 2, hexosediphosphatase, MGC142192, muscle fructose-bisphosphatase
Label Type:
Unlabeled
Quantity:
100μL
Research Category:
__
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52009. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
FBP2
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Source:
E.Coli