NBP258522PE
Novus Biologicals™ GOAT/MBOAT4 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258522PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258522PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
619373
Common Name
GOAT/MBOAT4 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
EC 2.3.1.-, ghrelin O-acyltransferase, GOATFKSG89, membrane bound O-acyltransferase domain containing 4, Membrane-bound O-acyltransferase domain-containing protein 4, OACT4, O-acyltransferase (membrane bound) domain containing 4, O-acyltransferase domain-
Label Type
Unlabeled
Quantity
100μL
Source
E.Coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
MBOAT4
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51449. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human GOAT/MBOAT4
- Source: E.coli Amino Acid Sequence: LDDSLLHAAGFGPELGQSPGEEGYVPDADIWTLERTHRISVFSRKWNQSTARWLRRLVFQHS The GOAT/MBOAT4 Recombinant Protein Antigen is derived from E
- coli
- The GOAT/MBOAT4 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 619373
Common Name: GOAT/MBOAT4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: EC 2.3.1.-, ghrelin O-acyltransferase, GOATFKSG89, membrane bound O-acyltransferase domain containing 4, Membrane-bound O-acyltransferase domain-containing protein 4, OACT4, O-acyltransferase (membrane bound) domain containing 4, O-acyltransferase domain-
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: MBOAT4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51449. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
619373
Common Name:
GOAT/MBOAT4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
EC 2.3.1.-, ghrelin O-acyltransferase, GOATFKSG89, membrane bound O-acyltransferase domain containing 4, Membrane-bound O-acyltransferase domain-containing protein 4, OACT4, O-acyltransferase (membrane bound) domain containing 4, O-acyltransferase domain-
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
MBOAT4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51449. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 7161
Common Name: p73 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: p53-related protein, P73p53-like transcription factor, TA p73, TAp73, tumor protein p73
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: TP73
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50062. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
7161
Common Name:
p73 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
p53-related protein, P73p53-like transcription factor, TA p73, TAp73, tumor protein p73
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
TP73
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50062. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 2821
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: AMFGNPI, Autocrine motility factor, DKFZp686C13233, EC 5.3.1.9, glucose phosphate isomerase, glucose-6-phosphate isomerase, hexose monophosphate isomerase, hexosephosphate isomerase, neuroleukin, NLKSA36, oxoisomerase, PGI, PHI, Phosphoglucose isomerase, phosphohexomutase, Phosphohexose isomerase, phosphosaccharomutase, SA-36, Sperm antigen 36, sperm antigen-36
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
2821
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
AMFGNPI, Autocrine motility factor, DKFZp686C13233, EC 5.3.1.9, glucose phosphate isomerase, glucose-6-phosphate isomerase, hexose monophosphate isomerase, hexosephosphate isomerase, neuroleukin, NLKSA36, oxoisomerase, PGI, PHI, Phosphoglucose isomerase, phosphohexomutase, Phosphohexose isomerase, phosphosaccharomutase, SA-36, Sperm antigen 36, sperm antigen-36
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 2821
Common Name: Glucose 6 phosphate isomerase Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: AMFGNPI, Autocrine motility factor, DKFZp686C13233, EC 5.3.1.9, glucose phosphate isomerase, glucose-6-phosphate isomerase, hexose monophosphate isomerase, hexosephosphate isomerase, neuroleukin, NLKSA36, oxoisomerase, PGI, PHI, Phosphoglucose isomerase,
Label Type: Unlabeled
Quantity: 100μL
Source: E.Coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: GPI
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50216. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
2821
Common Name:
Glucose 6 phosphate isomerase Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
AMFGNPI, Autocrine motility factor, DKFZp686C13233, EC 5.3.1.9, glucose phosphate isomerase, glucose-6-phosphate isomerase, hexose monophosphate isomerase, hexosephosphate isomerase, neuroleukin, NLKSA36, oxoisomerase, PGI, PHI, Phosphoglucose isomerase,
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.Coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
GPI
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50216. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml