NBP258657PE
Novus Biologicals™ LMO4 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258657PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258657PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
8543
Common Name
LMO4 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
Breast tumor autoantigen, LIM domain only 4, LIM domain only protein 4, LIM domain transcription factor LMO4, LMO-4
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
LMO4
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51482. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human LMO4
- Source: E.coli Amino Acid Sequence: GKIADRFLLYAMDSYWHSRCLKCSCCQAQLGDIGTSCYTKSGMILCRNDYIRLF The LMO4 Recombinant Protein Antigen is derived from E
- coli
- The LMO4 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 8543
Common Name: LMO4 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Breast tumor autoantigen, LIM domain only 4, LIM domain only protein 4, LIM domain transcription factor LMO4, LMO-4
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: LMO4
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51482. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8543
Common Name:
LMO4 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Breast tumor autoantigen, LIM domain only 4, LIM domain only protein 4, LIM domain transcription factor LMO4, LMO-4
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
LMO4
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-51482. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 8664
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: eIF3d, eIF3-p66, EIF3S7eIF3 p66, eIF-3-zeta, eIF3-zeta, Eukaryotic translation initiation factor 3 subunit 7, eukaryotic translation initiation factor 3 subunit D, eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa, eukaryotic translation initiation factor 3, subunit D, MGC126526, MGC17258, translation initiation factor eIF3 p66 subunit
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
8664
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
eIF3d, eIF3-p66, EIF3S7eIF3 p66, eIF-3-zeta, eIF3-zeta, Eukaryotic translation initiation factor 3 subunit 7, eukaryotic translation initiation factor 3 subunit D, eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa, eukaryotic translation initiation factor 3, subunit D, MGC126526, MGC17258, translation initiation factor eIF3 p66 subunit
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 8664
Common Name: EIF3D Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: eIF3d, eIF3-p66, EIF3S7eIF3 p66, eIF-3-zeta, eIF3-zeta, Eukaryotic translation initiation factor 3 subunit 7, eukaryotic translation initiation factor 3 subunit D, eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa, eukaryotic translatio
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: EIF3D
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50081. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
8664
Common Name:
EIF3D Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
eIF3d, eIF3-p66, EIF3S7eIF3 p66, eIF-3-zeta, eIF3-zeta, Eukaryotic translation initiation factor 3 subunit 7, eukaryotic translation initiation factor 3 subunit D, eukaryotic translation initiation factor 3, subunit 7 zeta, 66/67kDa, eukaryotic translatio
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
EIF3D
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-50081. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 4863
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: CAND3, E14, E14/NPAT, Nuclear Protein Of The Ataxia Telangiectasia Mutated Locus, Nuclear Protein Of The ATM Locus, Nuclear Protein, Ataxia-Telangiectasia Locus, Nuclear Protein, Coactivator Of Histone Transcription, Nuclear Protein, Co-Activator Of Histone Transcription, p220, Protein NPAT
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
4863
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
CAND3, E14, E14/NPAT, Nuclear Protein Of The Ataxia Telangiectasia Mutated Locus, Nuclear Protein Of The ATM Locus, Nuclear Protein, Ataxia-Telangiectasia Locus, Nuclear Protein, Coactivator Of Histone Transcription, Nuclear Protein, Co-Activator Of Histone Transcription, p220, Protein NPAT
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__