NBP258724PE
Novus Biologicals™ ANKRD37 Recombinant Protein Antigen
Manufacturer: Novus Biologicals™
Select a Size
| Pack Size | SKU | Availability | Price |
|---|---|---|---|
| Each of 1 | NBP258724PE-Each-of-1 | In Stock | ₹ 30,159.90 |
NBP258724PE - Each of 1
In Stock
Quantity
1
Base Price: ₹ 30,159.90
GST (18%): ₹ 5,428.782
Total Price: ₹ 35,588.682
Gene ID (Entrez)
353322
Common Name
ANKRD37 Recombinant Protein Antigen
Formulation
PBS and 1M Urea, pH 7.4.
Gene Alias
ankyrin repeat domain 37, ankyrin repeat domain-containing protein 37, hLrp2bp, low density lipoprotein receptor-related protein binding protein, Low-density lipoprotein receptor-related protein 2-binding protein, LPR2BP, Lrp2bp, MGC111507
Label Type
Unlabeled
Quantity
100μL
Source
E.coli
Purification Method
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application)
Blocking/Neutralizing, Control
Gene Symbol
ANKRD37
Product Type
Recombinant Protein Antigen
Regulatory Status
RUO
Specific Reactivity
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52224. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Related Products
Description
- A recombinant protein antigen with a N-terminal His6-ABP tag corresponding to human ANKRD37
- Source: E.coli Amino Acid Sequence: ASVNAPPDPCKQSPVHLAAGSGLACFLLWQLQTGADLNQQDVLGEAPLHKAAKVGSLECLSLLV The ANKRD37 Recombinant Protein Antigen is derived from E
- coli
- The ANKRD37 Recombinant Protein Antigen has been validated for the following applications: Antibody Competition.
Compare Similar Items
Show Difference
Gene ID (Entrez): 353322
Common Name: ANKRD37 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: ankyrin repeat domain 37, ankyrin repeat domain-containing protein 37, hLrp2bp, low density lipoprotein receptor-related protein binding protein, Low-density lipoprotein receptor-related protein 2-binding protein, LPR2BP, Lrp2bp, MGC111507
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: ANKRD37
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52224. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
353322
Common Name:
ANKRD37 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
ankyrin repeat domain 37, ankyrin repeat domain-containing protein 37, hLrp2bp, low density lipoprotein receptor-related protein binding protein, Low-density lipoprotein receptor-related protein 2-binding protein, LPR2BP, Lrp2bp, MGC111507
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
ANKRD37
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52224. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 6500
Common Name: Skp1 Recombinant Protein Antigen
Formulation: PBS and 1M Urea, pH 7.4.
Gene Alias: Cyclin-A/CDK2-associated protein p19, EMC19p19skp1, MGC34403, OCP2OCP-2, OCP-IIS-phase kinase-associated protein 1A (p19A), Organ of Corti protein 2, Organ of Corti protein II, p19Acyclin A/CDK2-associated p19, RNA polymerase II elongation factor-like pro
Label Type: Unlabeled
Quantity: 100μL
Source: E.coli
Purification Method: >80% by SDS-PAGE and Coomassie blue staining
Content And Storage: Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application): Blocking/Neutralizing, Control
Gene Symbol: SKP1
Product Type: Recombinant Protein Antigen
Regulatory Status: RUO
Specific Reactivity: This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52226. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez):
6500
Common Name:
Skp1 Recombinant Protein Antigen
Formulation:
PBS and 1M Urea, pH 7.4.
Gene Alias:
Cyclin-A/CDK2-associated protein p19, EMC19p19skp1, MGC34403, OCP2OCP-2, OCP-IIS-phase kinase-associated protein 1A (p19A), Organ of Corti protein 2, Organ of Corti protein II, p19Acyclin A/CDK2-associated p19, RNA polymerase II elongation factor-like pro
Label Type:
Unlabeled
Quantity:
100μL
Source:
E.coli
Purification Method:
>80% by SDS-PAGE and Coomassie blue staining
Content And Storage:
Store at −20°C. Avoid freeze-thaw cycles.
For Use With (Application):
Blocking/Neutralizing, Control
Gene Symbol:
SKP1
Product Type:
Recombinant Protein Antigen
Regulatory Status:
RUO
Specific Reactivity:
This recombinant antigen is only intended to be used as a blocking agent to confirm antibody specificity with the corresponding antibody, catalog number NBP2-52226. It is purified by IMAC chromatography, and the expected concentration is greater than 0.5 mg/ml
Gene ID (Entrez): 9238
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: cell cycle progression 2 protein, Cell cycle progression protein 2, Cell cycle progression restoration protein 2, CPR2, FAST kinase domains 4, FASTKD4Cpr2, KIAA0948H_TD2522F11.8, protein TBRG4, transforming growth factor beta regulator 4FAST kinase domain-containing protein 4
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
9238
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
cell cycle progression 2 protein, Cell cycle progression protein 2, Cell cycle progression restoration protein 2, CPR2, FAST kinase domains 4, FASTKD4Cpr2, KIAA0948H_TD2522F11.8, protein TBRG4, transforming growth factor beta regulator 4FAST kinase domain-containing protein 4
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__
Gene ID (Entrez): 84986
Common Name: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias: DKFZp313K217, MGC138804, MGC138805, MGC14258, putative RhoGAP protein, Rho GTPase activating protein 19, rho GTPase-activating protein 19, rho-type GTPase-activating protein 19
Label Type: __
Quantity: 100 μL
Source: __
Purification Method: Affinity Purified
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application): __
Gene Symbol: __
Product Type: __
Regulatory Status: RUO
Specific Reactivity: __
Gene ID (Entrez):
84986
Common Name:
__
Formulation:
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene Alias:
DKFZp313K217, MGC138804, MGC138805, MGC14258, putative RhoGAP protein, Rho GTPase activating protein 19, rho GTPase-activating protein 19, rho-type GTPase-activating protein 19
Label Type:
__
Quantity:
100 μL
Source:
__
Purification Method:
Affinity Purified
Content And Storage:
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
For Use With (Application):
__
Gene Symbol:
__
Product Type:
__
Regulatory Status:
RUO
Specific Reactivity:
__