PP2A alpha, p Tyr307 Antibody (SR1588), Novus Biologicals™
Rabbit Monoclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
PP2A alpha
Dilution
Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/Immunofluorescence 1:50-1:200, Immunoprecipitation 1:50
Classification
Monoclonal
Form
Purified
Regulatory Status
RUO
Target Species
Human, Mouse, Rat
Gene Alias
EC 3.1.3.16, PP2A-alpha, PP2Ac, PP2CA, PP2Calpha, protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform, protein phosphatase 2, catalytic subunit, alpha isozyme, protein phosphatase 2A catalytic subunit, alpha isoform, Replication protein C, RP-C, serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
Immunogen
A synthesized peptide derived from human phospho-PP2A alpha [Tyr307] (Uniprot #: P67775)
Primary or Secondary
Primary
Content And Storage
Store at -20 degrees C. Avoid freeze/thaw cycles.
Clone
SR1588
Applications
Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Conjugate
Unconjugated
Host Species
Rabbit
Research Discipline
Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Neuronal Cell Markers, Neurotransmission, Phospho Specific, Protein Phosphatase, Signal Transduction
Formulation
PBS, pH 7.4, 150mM NaCl, 50% glycerol.
Gene ID (Entrez)
5515
Isotype
IgG
Purification Method
Affinity purified
Related Products
Description
- PP2A alpha Monoclonal antibody specifically detects PP2A alpha in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Compare Similar Items
Show Difference
Antigen: PP2A alpha
Dilution: Western Blot 1:500-1:2000, Immunohistochemistry 1:50-1:200, Immunocytochemistry/Immunofluorescence 1:50-1:200, Immunoprecipitation 1:50
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: EC 3.1.3.16, PP2A-alpha, PP2Ac, PP2CA, PP2Calpha, protein phosphatase 2 (formerly 2A), catalytic subunit, alpha isoform, protein phosphatase 2, catalytic subunit, alpha isozyme, protein phosphatase 2A catalytic subunit, alpha isoform, Replication protein C, RP-C, serine/threonine protein phosphatase 2A, catalytic subunit, alpha isoform, serine/threonine-protein phosphatase 2A catalytic subunit alpha isoform
Immunogen: A synthesized peptide derived from human phospho-PP2A alpha [Tyr307] (Uniprot #: P67775)
Primary or Secondary: Primary
Content And Storage: Store at -20 degrees C. Avoid freeze/thaw cycles.
Clone: SR1588
Applications: Western Blot, Immunohistochemistry, Immunofluorescence, Immunoprecipitation
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair, Neuronal Cell Markers, Neurotransmission, Phospho Specific, Protein Phosphatase, Signal Transduction
Formulation: PBS, pH 7.4, 150mM NaCl, 50% glycerol.
Gene ID (Entrez): 5515
Isotype: IgG
Purification Method: Affinity purified
Antigen: SMNDC1
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: SMNRSMN-related protein, SPF30splicing factor 30, survival of motor neuron-related, survival motor neuron domain containing 1,30 kDa splicing factor SMNrp, Survival motor neuron domain-containing protein 1, survival of motor neuron-related-splicing factor 30
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: KELEQEREDQKVKWQQFNNRAYSKNKKGQVKRSIFASPESVTGKVGVGTCGIADKP
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Clone: __
Applications: Immunofluorescence
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Apoptosis
Formulation: PBS, pH 7.2, 40% glycerol
Gene ID (Entrez): 10285
Isotype: IgG
Purification Method: Affinity purified
Antigen: MVK
Dilution: Western Blot 1:500-1:2000, Flow Cytometry 1:50
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: EC 2.7.1.36, LH receptor mRNA-binding protein, LRBP, mevalonate kinase, mevalonate kinase (mevalonic aciduria), mevalonate kinase 1, MKFLJ96772, MVLK
Immunogen: A synthesized peptide derived from human MVK (Uniprot #: Q03426)
Primary or Secondary: Primary
Content And Storage: Store at -20° C. Avoid freeze/thaw cycles.
Clone: SR1713
Applications: Western Blot, Flow Cytometry
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: metabolism
Formulation: PBS, pH 7.4, 150mM NaCl, 50% glycerol.
Gene ID (Entrez): 4598
Isotype: IgG
Purification Method: Affinity purified
