BAFF/BLyS/TNFSF13B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
BAFF/BLyS/TNFSF13B
Applications
Immunofluorescence
Conjugate
Unconjugated
Host Species
Rabbit
Research Discipline
Apoptosis, Cell Cycle and Replication, Cytokine Research, Immunology
Formulation
PBS, pH 7.2, 40% glycerol
Gene ID (Entrez)
10673
Isotype
IgG
Purification Method
Affinity purified
Dilution
Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Classification
Polyclonal
Form
Purified
Regulatory Status
RUO
Target Species
Human
Gene Alias
ApoL related ligand TALL-1, B lymphocyte stimulator, BAFFB-cell activating factor, B-cell-activating factor, BLyS, BLYSB-lymphocyte stimulator, CD257, CD257 antigen, Dendritic cell-derived TNF-like molecule, DTL, TALL-1delta BAFF, TALL1Delta4 BAFF, THANK, TNF and ApoL-related leukocyte expressed ligand 1, TNF- and APOL-related leukocyte expressed ligand 1, TNF homolog that activates apoptosis, TNFSF20, tumor necrosis factor (ligand) superfamily, member 13b, tumor necrosis factor (ligand) superfamily, member 20, tumor necrosis factor ligand superfamily member 13B, tumor necrosis factor superfamily, member 13b, tumor necrosis factor-like protein ZTNF4, ZTNF4
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids: MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGK
Primary or Secondary
Primary
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- BAFF/BLyS/TNFSF13B Polyclonal antibody specifically detects BAFF/BLyS/TNFSF13B in Human samples
- It is validated for Immunofluorescence
Compare Similar Items
Show Difference
Antigen: BAFF/BLyS/TNFSF13B
Applications: Immunofluorescence
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Apoptosis, Cell Cycle and Replication, Cytokine Research, Immunology
Formulation: PBS, pH 7.2, 40% glycerol
Gene ID (Entrez): 10673
Isotype: IgG
Purification Method: Affinity purified
Dilution: Immunocytochemistry/Immunofluorescence 0.25-2 ug/ml
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: ApoL related ligand TALL-1, B lymphocyte stimulator, BAFFB-cell activating factor, B-cell-activating factor, BLyS, BLYSB-lymphocyte stimulator, CD257, CD257 antigen, Dendritic cell-derived TNF-like molecule, DTL, TALL-1delta BAFF, TALL1Delta4 BAFF, THANK, TNF and ApoL-related leukocyte expressed ligand 1, TNF- and APOL-related leukocyte expressed ligand 1, TNF homolog that activates apoptosis, TNFSF20, tumor necrosis factor (ligand) superfamily, member 13b, tumor necrosis factor (ligand) superfamily, member 20, tumor necrosis factor ligand superfamily member 13B, tumor necrosis factor superfamily, member 13b, tumor necrosis factor-like protein ZTNF4, ZTNF4
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids: MDDSTEREQSRLTSCLKKREEMKLKECVSILPRKESPSVRSSKDGK
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: VPS24
Applications: Western Blot, Flow Cytometry, Immunohistochemistry, Immunoprecipitation
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Autophagy, Cell Biology, Signal Transduction
Formulation: PBS, pH 7.4, 150mM NaCl, 50% glycerol.
Gene ID (Entrez): 51652
Isotype: IgG
Purification Method: Affinity purified
Dilution: Western Blot 1:500-1:2000, Flow Cytometry 1:50, Immunohistochemistry 1:50-1:200, Immunoprecipitation 1:50
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: CGI-149, CHMP325.1 protein, Chromatin-modifying protein 3, hVps24, member 3,25.1, NEDFFLJ38114, vacuolar protein sorting 24 (yeast), vacuolar protein sorting 24 homolog (S. cerevisiae)
Immunogen: A synthesized peptide derived from human VPS24 (Uniprot #: Q9Y3E7)
Primary or Secondary: Primary
Content And Storage: Store at -20° C. Avoid freeze/thaw cycles.
Antigen: Myogenin
Applications: Western Blot, Flow Cytometry, Immunohistochemistry
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Cancer, Stem Cell Markers, Transcription Factors and Regulators
Formulation: PBS, pH 7.4, 150mM NaCl, 50% glycerol.
Gene ID (Entrez): 4656
Isotype: IgG
Purification Method: Affinity purified
Dilution: Western Blot 1:500-1:2000, Flow Cytometry 1:40, Immunohistochemistry 1:50-1:200
Classification: Monoclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: BHLHC3, bHLHc3Myogenic factor-4; myogenin, Class C basic helix-loop-helix protein 3, myf-4, MYF4myogenin, Myogenic factor 4, MYOGENIN, myogenin (myogenic factor 4)
Immunogen: A synthesized peptide derived from human Myogenin (Uniprot #: P15173)
Primary or Secondary: Primary
Content And Storage: Store at -20° C. Avoid freeze/thaw cycles.