IGFBP-1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
IGFBP-1
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
alpha-pregnancy-associated endometrial globulin, amniotic fluid binding protein, binding protein-25, binding protein-26, binding protein-28, growth hormone independent-binding protein, hIGFBP-1, IBP1, IBP-1, IGF-binding protein 1, IGFBP-1, IGF-BP25, insulin-like growth factor binding protein 1, insulin-like growth factor-binding protein 1, Placental protein 12, PP12AFBP
Gene Symbols
IGFBP1
Isotype
IgG
Purification Method
Affinity Purified
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Accession No.
P08833
Gene ID (Entrez)
3484
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: QQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGS
Primary or Secondary
Primary
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- IGFBP-1 Polyclonal specifically detects IGFBP-1 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: IGFBP-1
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: alpha-pregnancy-associated endometrial globulin, amniotic fluid binding protein, binding protein-25, binding protein-26, binding protein-28, growth hormone independent-binding protein, hIGFBP-1, IBP1, IBP-1, IGF-binding protein 1, IGFBP-1, IGF-BP25, insulin-like growth factor binding protein 1, insulin-like growth factor-binding protein 1, Placental protein 12, PP12AFBP
Gene Symbols: IGFBP1
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:2500 - 1:5000
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Accession No.: P08833
Gene ID (Entrez): 3484
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: QQPLHALTRGQGACVQESDASAPHAAEAGSPESPESTEITEEELLDNFHLMAPSEEDHSILWDAISTYDGS
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: LRRC2
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: leucine rich repeat containing 2, leucine-rich repeat-containing 2, leucine-rich repeat-containing protein 2
Gene Symbols: LRRC2
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Accession No.: __
Gene ID (Entrez): 79442
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LREWYISNTLIQIIPTYIQLFQAMRILDLPKNQISHLPAEIGCLKNLKELNVGFNYLKSIPPELGDCENLERLDCSGN
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: KCTD20
Applications: __
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: BTB/POZ domain-containing protein KCTD20, potassium channel tetramerisation domain containing 20
Gene Symbols: KCTD20
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of human KCTD20 antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: __
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Accession No.: __
Gene ID (Entrez): 222658
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LAEDIKGSCFQSGNKRNHEPFIAPERFGNSSVGFGSNSHSQAPEKVTLLVDGTRFVVNPQIFTAHPDTML
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.