MGAT4B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
MGAT4B
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, alpha-1,3-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, aminyltransferase, EC 2.4.1.145, GlcNAc-T IVb, GNT-IV, GNT-IVB, isoenzyme B, isozyme B, mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, N-acetylglucosaminyltransferase IVb, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb, UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IV, UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IVb
Gene Symbols
MGAT4B
Isotype
IgG
Purification Method
Affinity Purified
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Cytokine Research
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
11282
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: VVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLL
Primary or Secondary
Primary
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- MGAT4B Polyclonal specifically detects MGAT4B in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: MGAT4B
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: alpha-1,3-mannosyl-glycoprotein 4-beta-N-acetylglucosaminyltransferase B, alpha-1,3-mannosyl-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, aminyltransferase, EC 2.4.1.145, GlcNAc-T IVb, GNT-IV, GNT-IVB, isoenzyme B, isozyme B, mannosyl (alpha-1,3-)-glycoprotein beta-1,4-N-acetylglucosaminyltransferase, N-acetylglucosaminyltransferase IVb, N-glycosyl-oligosaccharide-glycoprotein N-acetylglucosaminyltransferase IVb, UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IV, UDP-N-acetylglucosamine: alpha-1,3-D-mannosidebeta-1,4-N-acetylglucosaminyltransferase IVb
Gene Symbols: MGAT4B
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Cytokine Research
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 11282
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: VVDVYQREFLALRDRLHAAEQESLKRSKELNLVLDEIKRAVSERQALRDGDGNRTWGRLTEDPRLKPWNGSHRHVLHLPTVFHHLPHLL
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: ADAMTS9
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: ADAM metallopeptidase with thrombospondin type 1 motif, 9, ADAMTS-9,9, FLJ42955
Gene Symbols: ADAMTS9
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 56999
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:GDYFIEPLQSMDEQEDEEEQNKPHIIYRRSAPQREPSTGRHACDTSEHKNRHSKDKKKTRARKWGERINLAGD
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: ZNFN1A4
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: EOS, IKAROS family zinc finger 4 (Eos), Ikaros family zinc finger protein 4, KIAA1782Eos, zinc finger protein, subfamily 1A, 4 (Eos), zinc finger transcription factor Eos, ZNFN1A4zinc finger protein Eos
Gene Symbols: IKZF4
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 64375
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: LQLQLYLPSCSLLQGSGDSSLEKEFLGAPVGPSVSTPNSQHSSPSRSLSANSIKVEMYSDEESSRLLGPDERLLEKDDSVIVEDSLSEPLGYCDGSG
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
