SLC37A4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
SLC37A4
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
G6PT, G6PT1G6PT3, G6PT2, Glucose-5-phosphate transporter, glucose-6-phosphatase, transport (glucose) protein 3, glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1, glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2, glucose-6-phosphate translocase, GSD1b, GSD1c, GSD1d, MGC15729, microsomal glucose-6-phosphate transporter, solute carrier family 37 (glucose-6-phosphate transporter), member 4, Solute carrier family 37 member 4, Transformation-related gene 19 protein, TRG19, TRG-19
Gene Symbols
SLC37A4
Isotype
IgG
Purification Method
Affinity Purified
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Accession No.
None
Gene ID (Entrez)
2542
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: LDKDDLGFITSSQSAAYAISKFVSGVLSDQMS
Primary or Secondary
Primary
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- SLC37A4 Polyclonal specifically detects SLC37A4 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SLC37A4
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: G6PT, G6PT1G6PT3, G6PT2, Glucose-5-phosphate transporter, glucose-6-phosphatase, transport (glucose) protein 3, glucose-6-phosphatase, transport (glucose-6-phosphate) protein 1, glucose-6-phosphatase, transport (phosphate/pyrophosphate) protein 2, glucose-6-phosphate translocase, GSD1b, GSD1c, GSD1d, MGC15729, microsomal glucose-6-phosphate transporter, solute carrier family 37 (glucose-6-phosphate transporter), member 4, Solute carrier family 37 member 4, Transformation-related gene 19 protein, TRG19, TRG-19
Gene Symbols: SLC37A4
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Accession No.: None
Gene ID (Entrez): 2542
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: LDKDDLGFITSSQSAAYAISKFVSGVLSDQMS
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: PCDHA8
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: KIAA0345-like 6, PCDH-alpha-8, PCDH-ALPHA8, protocadherin alpha 8, protocadherin alpha-8
Gene Symbols: PCDHA8
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:200 - 1:500
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Accession No.: __
Gene ID (Entrez): 56140
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:PCLPPDLGSVDVGEEQDLNVDHGLKVSPFKFRTHKFYLWKL
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: CCDC24
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: Coiled-Coil Domain Containing 24, Coiled-Coil Domain-Containing Protein 24, RP5-1198O20.2
Gene Symbols: CCDC24
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Accession No.: Q8N4L8
Gene ID (Entrez): 149473
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: SLWELVEEHVPLRERREVKRILGEAAVDLSLELRAEVAMLRALLQEARSSQAPSSRPISDPSSLLAP
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
