Fc gamma RIIIA/CD16a Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Fc gamma RIIIA/CD16a
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Accession No.
P08637
Gene ID (Entrez)
2214
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: FSVKTNIRSSTRDWKDHKFKWRKDPQDK
Primary or Secondary
Primary
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution
Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Cell Biology, Cellular Markers, Cytokine Research, Growth and Development, Hematopoietic Stem Cell Markers, Immunology, Innate Immunity, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Stem Cells
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
CD16a, CD16a antigen, CD16FCRIIIA, Fc fragment of IgG, low affinity IIIa, receptor (CD16a), Fc fragment of IgG, low affinity IIIa, receptor for (CD16), Fc gamma receptor III-A, FCG3, Fc-gamma receptor III-2 (CD 16), Fc-gamma receptor IIIb (CD16), Fc-gamma RIII, Fc-gamma RIIIa, Fc-gamma RIII-alpha, FCGR3, FCGRIII, FCR-10, FcRIII, FcRIIIa, IGFR3FcgammaRIIIA, immunoglobulin G Fc receptor III, low affinity III, receptor for (CD16), low affinity immunoglobulin gamma Fc region receptor III-A, neutrophil-specific antigen NA
Gene Symbols
FCGR3A
Isotype
IgG
Purification Method
Affinity Purified
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Description
- Fc gamma RIIIA/CD16a Polyclonal specifically detects Fc gamma RIIIA/CD16a in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Fc gamma RIIIA/CD16a
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Accession No.: P08637
Gene ID (Entrez): 2214
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: FSVKTNIRSSTRDWKDHKFKWRKDPQDK
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution: Immunohistochemistry 1:200 - 1:500, Immunohistochemistry-Paraffin 1:200 - 1:500
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Cell Biology, Cellular Markers, Cytokine Research, Growth and Development, Hematopoietic Stem Cell Markers, Immunology, Innate Immunity, Neuronal Cell Markers, Neuroscience, Stem Cell Markers, Stem Cells
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: CD16a, CD16a antigen, CD16FCRIIIA, Fc fragment of IgG, low affinity IIIa, receptor (CD16a), Fc fragment of IgG, low affinity IIIa, receptor for (CD16), Fc gamma receptor III-A, FCG3, Fc-gamma receptor III-2 (CD 16), Fc-gamma receptor IIIb (CD16), Fc-gamma RIII, Fc-gamma RIIIa, Fc-gamma RIII-alpha, FCGR3, FCGRIII, FCR-10, FcRIII, FcRIIIa, IGFR3FcgammaRIIIA, immunoglobulin G Fc receptor III, low affinity III, receptor for (CD16), low affinity immunoglobulin gamma Fc region receptor III-A, neutrophil-specific antigen NA
Gene Symbols: FCGR3A
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: TM2D1
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Accession No.: __
Gene ID (Entrez): 83941
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: CEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNG
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: BBPBeta-amyloid-binding protein, hBBP, TM2 domain containing 1, TM2 domain-containing protein 1
Gene Symbols: TM2D1
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: TM2D1
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Accession No.: __
Gene ID (Entrez): 83941
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: CEDLKVGQYICKDPKINDATQEPVNCTNYTAHVSCFPAPNITCKDSSGNETHFTGNEVGFFKPISCRNVNG
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution: Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: BBPBeta-amyloid-binding protein, hBBP, TM2 domain containing 1, TM2 domain-containing protein 1
Gene Symbols: TM2D1
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.