AGPAT2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
AGPAT2
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
1-acylglycerol-3-phosphate O-acyltransferase 2, 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acidacyltransferase, beta), 1-AGPAT 2,1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acidacyltransferase-beta), 1-AGPAT2,1-AGP acyltransferase 2,1-acyl-sn-glycerol-3-phosphate acyltransferase beta, Berardinelli-Seip congenital lipodystrophy, BSCL, BSCL1, EC 2.3.1.51, LPAAB, LPAAT-beta, Lysophosphatidic acid acyltransferase beta, lysophosphatidic acid acyltransferase-beta
Gene Symbols
AGPAT2
Isotype
IgG
Purification Method
Affinity Purified
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Accession No.
O15120
Gene ID (Entrez)
10555
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:YNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSG
Primary or Secondary
Primary
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- AGPAT2 Polyclonal specifically detects AGPAT2 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: AGPAT2
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: 1-acylglycerol-3-phosphate O-acyltransferase 2, 1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acidacyltransferase, beta), 1-AGPAT 2,1-acylglycerol-3-phosphate O-acyltransferase 2 (lysophosphatidic acidacyltransferase-beta), 1-AGPAT2,1-AGP acyltransferase 2,1-acyl-sn-glycerol-3-phosphate acyltransferase beta, Berardinelli-Seip congenital lipodystrophy, BSCL, BSCL1, EC 2.3.1.51, LPAAB, LPAAT-beta, Lysophosphatidic acid acyltransferase beta, lysophosphatidic acid acyltransferase-beta
Gene Symbols: AGPAT2
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry 1:20 - 1:50, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Accession No.: O15120
Gene ID (Entrez): 10555
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:YNTKKKFFTSGTVTVQVLEAIPTSGLTAADVPALVDTCHRAMRTTFLHISKTPQENGATAGSG
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: PCDHA3
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: KIAA0345-like 11, MGC141669, PCDH-alpha-3, PCDH-ALPHA3, protocadherin alpha 3, protocadherin alpha-3
Gene Symbols: PCDHA3
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Accession No.: __
Gene ID (Entrez): 56145
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LLTYSLDSTEYFTLDVKRNDEEIKSLGLVLKKNLNREDTPKHYLLITAI
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: PCDHA3
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin), Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: KIAA0345-like 11, MGC141669, PCDH-alpha-3, PCDH-ALPHA3, protocadherin alpha 3, protocadherin alpha-3
Gene Symbols: PCDHA3
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Immunohistochemistry 1:1000 - 1:2500, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Accession No.: __
Gene ID (Entrez): 56145
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:LLTYSLDSTEYFTLDVKRNDEEIKSLGLVLKKNLNREDTPKHYLLITAI
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
