SLC25A23 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
SLC25A23
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
79085
Immunogen
This antibody was developed against a recombinant protein corresponding to the amino acids: GRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLD
Primary or Secondary
Primary
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution
Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Alias
APC2FLJ30339, calcium-binding mitochondrial carrier protein SCaMC-3, MCSC2, MGC2615, Mitochondrial ATP-Mg/Pi carrier protein 2, Mitochondrial Ca(2+)-dependent solute carrier protein 2, mitochondrial Ca2+-dependent solute carrier protein 2, SCaMC-3, SCAMC3, short calcium-binding mitochondrial carrier 3, Small calcium-binding mitochondrial carrier protein 3, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23, Solute carrier family 25 member 23
Gene Symbols
SLC25A23
Isotype
IgG
Purification Method
Affinity Purified
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- SLC25A23 Polyclonal specifically detects SLC25A23 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SLC25A23
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 79085
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: GRLFEELDSNKDGRVDVHELRQGLARLGGGNPDPGAQQGISSEGDADPDGGLD
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution: Western Blot 0.4 ug/ml, Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: APC2FLJ30339, calcium-binding mitochondrial carrier protein SCaMC-3, MCSC2, MGC2615, Mitochondrial ATP-Mg/Pi carrier protein 2, Mitochondrial Ca(2+)-dependent solute carrier protein 2, mitochondrial Ca2+-dependent solute carrier protein 2, SCaMC-3, SCAMC3, short calcium-binding mitochondrial carrier 3, Small calcium-binding mitochondrial carrier protein 3, solute carrier family 25 (mitochondrial carrier; phosphate carrier), member 23, Solute carrier family 25 member 23
Gene Symbols: SLC25A23
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: MISP1
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 126353
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: SQASGITGSYSVSESPFFSPIHLHSNVAWTVEDPVDSAPPGQRKKEQWYAGINPSDGINSEVLEAIRVTRHKNAMAERWESRIYASEEDD
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution: __
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: chromosome 19 open reading frame 21, DKFZp686H18209, hypothetical protein LOC126353
Gene Symbols: MISP
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: GRTP1
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 79774
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: VALTLIKQHQELILEATSVPDICDKFKQITKGSFVMECHTFMQKIFSEPGSLSMATVAKLRESCR
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:20 - 1:50
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: FLJ22474, growth hormone regulated TBC protein 1, growth hormone-regulated TBC protein 1, MGC138328, TBC1 domain family member 6, TBC1 domain family, member 6, TBC1D6MGC138330
Gene Symbols: GRTP1
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
