hydroxysteroid (17-beta) dehydrogenase 11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
hydroxysteroid (17-beta) dehydrogenase 11
Applications
Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
17betaHSD11, 17betaHSDXI, 17-beta-hydroxysteroid dehydrogenase 11, 17-beta-hydroxysteroid dehydrogenase type XI, 17-beta-hydroxysteroid dehydrogenase XI, 17bHSD11, CTCL-associated antigen HD-CL-03, dehydrogenase/reductase (SDR family) member 8, DHRS8, EC 1.1.1, EC 1.1.1.62, hydroxysteroid (17-beta) dehydrogenase 11, member 2,17-beta-HSD 11, PAN1BRETSDR2,17-BETA-HSD11, retSDR2, RetSDR2,17-BETA-HSDXI, SDR16C2,17BHSD11, T-cell lymphoma-associated antigen HD-CL-03,17-beta-HSD XI
Gene Symbols
HSD17B11
Isotype
IgG
Purification Method
Affinity Purified
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution
Western Blot 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Lipid and Metabolism
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
51170
Immunogen
This antibody was developed against Recombinant Protein corresponding to amino acids:FVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKRKISVKFDAVIGY
Primary or Secondary
Primary
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Related Products
Description
- hydroxysteroid (17-beta) dehydrogenase 11 Polyclonal specifically detects hydroxysteroid (17-beta) dehydrogenase 11 in Human samples
- It is validated for Western Blot, Simple Western, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: hydroxysteroid (17-beta) dehydrogenase 11
Applications: Western Blot, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: 17betaHSD11, 17betaHSDXI, 17-beta-hydroxysteroid dehydrogenase 11, 17-beta-hydroxysteroid dehydrogenase type XI, 17-beta-hydroxysteroid dehydrogenase XI, 17bHSD11, CTCL-associated antigen HD-CL-03, dehydrogenase/reductase (SDR family) member 8, DHRS8, EC 1.1.1, EC 1.1.1.62, hydroxysteroid (17-beta) dehydrogenase 11, member 2,17-beta-HSD 11, PAN1BRETSDR2,17-BETA-HSD11, retSDR2, RetSDR2,17-BETA-HSDXI, SDR16C2,17BHSD11, T-cell lymphoma-associated antigen HD-CL-03,17-beta-HSD XI
Gene Symbols: HSD17B11
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Western Blot 0.4 ug/ml, Simple Western 1:25, Immunohistochemistry 1:50 - 1:200, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Lipid and Metabolism
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 51170
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:FVNTGFIKNPSTSLGPTLEPEEVVNRLMHGILTEQKMIFIPSSIAFLTTLERILPERFLAVLKRKISVKFDAVIGY
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: FBXL22
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: Fbl22, F-box and leucine-rich repeat protein 22FLJ39626, F-box/LRR-repeat protein 22, MGC75496
Gene Symbols: FBXL22
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 283807
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: HITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTELQKDNFLLGPALRSLSICWHS
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Antigen: FBXL22
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: Fbl22, F-box and leucine-rich repeat protein 22FLJ39626, F-box/LRR-repeat protein 22, MGC75496
Gene Symbols: FBXL22
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Western Blot 1:100 - 1:250, Immunocytochemistry/Immunofluorescence 1 - 4 ug/ml
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 283807
Immunogen: This antibody was developed against a recombinant protein corresponding to the amino acids: HITQLNRECLLHLFSFLDKDSRKSLARTCSQLHDVFEDPALWSLLHFRSLTELQKDNFLLGPALRSLSICWHS
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
