ALG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ALG1
Applications
Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
56052
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: NWHIRAVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDPVTERSAFTERDAGSGLVTRLRERP
Primary or Secondary
Primary
Content And Storage
Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution
Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Alias
asparagine-linked glycosylation 1 homolog (yeast, beta-1,4-mannosyltransferase), asparagine-linked glycosylation 1, beta-1,4-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 1 homolog, beta-1,4 mannosyltransferase, beta-1,4-mannosyltransferase, chitobiosyldiphosphodolichol beta-mannosyltransferase, GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase, GDP-mannose-dolichol diphosphochitobiose mannosyltransferase, hMat-1, HMAT1EC 2.4.1.142, HMT-1, HMT1CDG1K, Mannosyltransferase-1, MT-1
Gene Symbols
ALG1
Isotype
IgG
Purification Method
Affinity Purified
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- ALG1 Polyclonal specifically detects ALG1 in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ALG1
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 56052
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: NWHIRAVTVYDKPASFFKETPLDLQHRLFMKLGSMHSPFRARSEPEDPVTERSAFTERDAGSGLVTRLRERP
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:500 - 1:1000
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: asparagine-linked glycosylation 1 homolog (yeast, beta-1,4-mannosyltransferase), asparagine-linked glycosylation 1, beta-1,4-mannosyltransferase homolog (S.cerevisiae), Asparagine-linked glycosylation protein 1 homolog, beta-1,4 mannosyltransferase, beta-1,4-mannosyltransferase, chitobiosyldiphosphodolichol beta-mannosyltransferase, GDP-Man:GlcNAc2-PP-dolichol mannosyltransferase, GDP-mannose-dolichol diphosphochitobiose mannosyltransferase, hMat-1, HMAT1EC 2.4.1.142, HMT-1, HMT1CDG1K, Mannosyltransferase-1, MT-1
Gene Symbols: ALG1
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: GPR108
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 56927
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VGFSLSRVRSGRVRSYSTRDFQDCPLQKNSSSFLVLFLINTKDLQVQVRKYGEQKTLFIFPGLLPEAPSKPGLPKPQATVPRKVDG
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: G protein-coupled receptor 108, LUSTR2Lung seven transmembrane receptor 2, MGC14393, protein GPR108
Gene Symbols: GPR108
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: GPR108
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 56927
Immunogen: This antibody was developed against Recombinant Protein corresponding to amino acids:VGFSLSRVRSGRVRSYSTRDFQDCPLQKNSSSFLVLFLINTKDLQVQVRKYGEQKTLFIFPGLLPEAPSKPGLPKPQATVPRKVDG
Primary or Secondary: Primary
Content And Storage: Store at 4C short term. Aliquot and store at -20C long term. Avoid freeze-thaw cycles.
Dilution: Immunohistochemistry, Immunocytochemistry/Immunofluorescence 1-4 ug/ml, Immunohistochemistry-Paraffin 1:50 - 1:200
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: G protein-coupled receptor 108, LUSTR2Lung seven transmembrane receptor 2, MGC14393, protein GPR108
Gene Symbols: GPR108
Isotype: IgG
Purification Method: Affinity Purified
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
