ATP6V1C1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ATP6V1C1
Applications
Western Blot
Conjugate
Unconjugated
Host Species
Rabbit
Research Discipline
Endocrinology, Signal Transduction
Formulation
PBS with 50% glycerol, pH7.3.
Gene ID (Entrez)
528
Isotype
IgG
Purification Method
Affinity purified
Dilution
Western Blot 1:500-1:2000
Classification
Polyclonal
Form
Purified
Regulatory Status
RUO
Target Species
Human, Mouse
Gene Alias
ATP6CH+-transporting ATPase chain C, vacuolar, ATP6Dsubunit C of vacuolar proton-ATPase V1 domain, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 42kD, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C, isoform 1, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1, FLJ20057, H(+)-transporting two-sector ATPase, subunit C, vacuolar ATP synthase subunit C, vacuolar proton pump C subunit, Vacuolar proton pump subunit C 1, vacuolar proton pump, 42-kD subunit, vacuolar proton-ATPase, subunit C, VI domain, VATCH+ -ATPase C subunit, V-ATPase C subunit, V-ATPase subunit C 1, Vma5, V-type proton ATPase subunit C 1
Immunogen
A synthetic peptide corresponding to a sequence within amino acids 300-382 of human ATP6V1C1 (NP_001686.1). LRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK
Primary or Secondary
Primary
Content And Storage
Store at -20°C. Avoid freeze-thaw cycles.
Related Products
Description
- ATP6V1C1 Polyclonal antibody specifically detects ATP6V1C1 in Human, Mouse samples
- It is validated for Western Blot
Compare Similar Items
Show Difference
Antigen: ATP6V1C1
Applications: Western Blot
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Endocrinology, Signal Transduction
Formulation: PBS with 50% glycerol, pH7.3.
Gene ID (Entrez): 528
Isotype: IgG
Purification Method: Affinity purified
Dilution: Western Blot 1:500-1:2000
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse
Gene Alias: ATP6CH+-transporting ATPase chain C, vacuolar, ATP6Dsubunit C of vacuolar proton-ATPase V1 domain, ATPase, H+ transporting, lysosomal (vacuolar proton pump) 42kD, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C, isoform 1, ATPase, H+ transporting, lysosomal 42kDa, V1 subunit C1, FLJ20057, H(+)-transporting two-sector ATPase, subunit C, vacuolar ATP synthase subunit C, vacuolar proton pump C subunit, Vacuolar proton pump subunit C 1, vacuolar proton pump, 42-kD subunit, vacuolar proton-ATPase, subunit C, VI domain, VATCH+ -ATPase C subunit, V-ATPase C subunit, V-ATPase subunit C 1, Vma5, V-type proton ATPase subunit C 1
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 300-382 of human ATP6V1C1 (NP_001686.1). LRVFVESVLRYGLPVNFQAMLLQPNKKTLKKLREVLHELYKHLDSSAAAIIDAPMDIPGLNLSQQEYYPYVYYKIDCNLLEFK
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: Cyclin G
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Cell Cycle and Replication
Formulation: PBS with 50% glycerol, pH7.3.
Gene ID (Entrez): 900
Isotype: IgG
Purification Method: Affinity purified
Dilution: Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: CCNG, CYCG1, cyclin G1, Cyclin-G, cyclin-G1
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-295 of human Cyclin G (NP_004051.1). PSVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRDLTFWQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: Cyclin G
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Cell Cycle and Replication
Formulation: PBS with 50% glycerol, pH7.3.
Gene ID (Entrez): 900
Isotype: IgG
Purification Method: Affinity purified
Dilution: Western Blot 1:500 - 1:1000, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: CCNG, CYCG1, cyclin G1, Cyclin-G, cyclin-G1
Immunogen: A synthetic peptide corresponding to a sequence within amino acids 200-295 of human Cyclin G (NP_004051.1). PSVLALSIIALEIQAQKCVELTEGIECLQKHSKINGRDLTFWQELVSKCLTEYSSNKCSKPNVQKLKWIVSGRTARQLKHSYYRITHLPTIPEMVP
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.