Sodium Potassium ATPase Alpha 1 Antibody - Azide and BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Sodium Potassium ATPase Alpha 1
Applications
Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Host Species
Rabbit
Research Discipline
Cancer, Cellular Markers, Growth and Development, Hypoxia, Neuronal Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction
Formulation
PBS (pH 7.3), 50% glycerol
Gene ID (Entrez)
476
Isotype
IgG
Purification Method
Affinity purified
Dilution
Western Blot 1:100 - 1:500, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Classification
Polyclonal
Form
Purified
Regulatory Status
RUO
Target Species
Human, Mouse, Rat
Gene Alias
ATPase, Na+/K+ transporting, alpha 1 polypeptide, EC 3.6.3, EC 3.6.3.9, K-ATPase alpha-1 subunit, K-ATPase catalytic subunit alpha-A protein, MGC3285, MGC51750, Na, Na(+)/K(+) ATPase alpha-1 subunit, Na, K-ATPase, alpha-A catalytic polypeptide, Na+, K+ ATPase alpha subunit, Na+/K+ ATPase 1, sodium pump 1, Sodium pump subunit alpha-1, sodium/potassium-transporting ATPase subunit alpha-1, sodium-potassium-ATPase, alpha 1 polypeptide
Immunogen
Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Sodium Potassium ATPase Alpha 1 (NP_000692.2). MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF
Primary or Secondary
Primary
Content And Storage
Store at -20°C. Avoid freeze-thaw cycles.
Related Products
Description
- Sodium Potassium ATPase Alpha 1 Polyclonal antibody specifically detects Sodium Potassium ATPase Alpha 1 in Human, Mouse, Rat samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Compare Similar Items
Show Difference
Antigen: Sodium Potassium ATPase Alpha 1
Applications: Western Blot, Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: Cancer, Cellular Markers, Growth and Development, Hypoxia, Neuronal Cell Markers, Neuroscience, Plasma Membrane Markers, Signal Transduction
Formulation: PBS (pH 7.3), 50% glycerol
Gene ID (Entrez): 476
Isotype: IgG
Purification Method: Affinity purified
Dilution: Western Blot 1:100 - 1:500, Immunohistochemistry 1:50 - 1:200, Immunohistochemistry-Paraffin
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: ATPase, Na+/K+ transporting, alpha 1 polypeptide, EC 3.6.3, EC 3.6.3.9, K-ATPase alpha-1 subunit, K-ATPase catalytic subunit alpha-A protein, MGC3285, MGC51750, Na, Na(+)/K(+) ATPase alpha-1 subunit, Na, K-ATPase, alpha-A catalytic polypeptide, Na+, K+ ATPase alpha subunit, Na+/K+ ATPase 1, sodium pump 1, Sodium pump subunit alpha-1, sodium/potassium-transporting ATPase subunit alpha-1, sodium-potassium-ATPase, alpha 1 polypeptide
Immunogen: Recombinant fusion protein containing a sequence corresponding to amino acids 1-100 of human Sodium Potassium ATPase Alpha 1 (NP_000692.2). MGKGVGRDKYEPAAVSEQGDKKGKKGKKDRDMDELKKEVSMDDHKLSLDELHRKYGTDLSRGLTSARAAEILARDGPNALTPPPTTPEWIKFCRQLFGGF
Primary or Secondary: Primary
Content And Storage: Store at -20°C. Avoid freeze-thaw cycles.
Antigen: CSAD
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: __
Formulation: PBS (pH 7.0)
Gene ID (Entrez): 51380
Isotype: IgG
Purification Method: Antigen and protein A Affinity-purified
Dilution: Immunohistochemistry-Paraffin 1:50-1:200
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: CSDMGC119355, cysteine sulfinic acid decarboxylase, Cysteine-sulfinate decarboxylase, EC 4.1.1, EC 4.1.1.29, FLJ44987, FLJ45500, MGC119354, MGC119357, PCAP, P-selectin cytoplasmic tail-associated protein, Sulfinoalanine decarboxylase
Immunogen: Produced in rabbits immunized with E. coli-derived Human CSAD fragment.
Primary or Secondary: Primary
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.
Antigen: CSAD
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Host Species: Rabbit
Research Discipline: __
Formulation: PBS (pH 7.0)
Gene ID (Entrez): 51380
Isotype: IgG
Purification Method: Antigen and protein A Affinity-purified
Dilution: Immunohistochemistry-Paraffin 1:50-1:200
Classification: Polyclonal
Form: Purified
Regulatory Status: RUO
Target Species: Human
Gene Alias: CSDMGC119355, cysteine sulfinic acid decarboxylase, Cysteine-sulfinate decarboxylase, EC 4.1.1, EC 4.1.1.29, FLJ44987, FLJ45500, MGC119354, MGC119357, PCAP, P-selectin cytoplasmic tail-associated protein, Sulfinoalanine decarboxylase
Immunogen: Produced in rabbits immunized with E. coli-derived Human CSAD fragment.
Primary or Secondary: Primary
Content And Storage: Store at 4°C short term. Aliquot and store at -20°C long term. Avoid freeze-thaw cycles.