5-Lipoxygenase Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
5-Lipoxygenase
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Cancer, Cholesterol Metabolism, Lipid and Metabolism, Neuroscience, Signal Transduction
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
240
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWY
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
5-lipoxygenase, 5-LO, 5-LOX, 5LPG, arachidonate 5-lipoxygenase, arachidonic 5-lipoxygenase alpha-10 isoform, arachidonic 5-lipoxygenase delta-10-13 isoform, arachidonic 5-lipoxygenase delta-13 isoform, arachidonic 5-lipoxygenase delta-p10 isoform, arachidonic acid 5-lipoxygenase, EC 1.13.11, EC 1.13.11.34, leukotriene A4 synthase, LOG5, MGC163204
Gene Symbols
ALOX5
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- 5-Lipoxygenase Polyclonal specifically detects 5-Lipoxygenase in Human samples
- It is validated for Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: 5-Lipoxygenase
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Cancer, Cholesterol Metabolism, Lipid and Metabolism, Neuroscience, Signal Transduction
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 240
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MPSYTVTVATGSQWFAGTDDYIYLSLVGSAGCSEKHLLDKPFYNDFERGAVDSYDVTVDEELGEIQLVRIEKRKYWLNDDWY
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: 5-lipoxygenase, 5-LO, 5-LOX, 5LPG, arachidonate 5-lipoxygenase, arachidonic 5-lipoxygenase alpha-10 isoform, arachidonic 5-lipoxygenase delta-10-13 isoform, arachidonic 5-lipoxygenase delta-13 isoform, arachidonic 5-lipoxygenase delta-p10 isoform, arachidonic acid 5-lipoxygenase, EC 1.13.11, EC 1.13.11.34, leukotriene A4 synthase, LOG5, MGC163204
Gene Symbols: ALOX5
Isotype: IgG
Purification Method: Affinity Purified
Antigen: CECR6
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 27439
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PPPPPQGGSQLGHCISENEGGAHGYVNTLAVASQN
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: Cat Eye Syndrome Chromosome Region, Candidate 6
Gene Symbols: CECR6
Isotype: IgG
Purification Method: Affinity Purified
Antigen: FAM205A
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 259308
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EDSMFSAAAKVAKTRKENVAKSLAPAKSPVGRSKTEKPTGCSKAQSRPAQKLVGPAFLDGPQSLDDKLRLHSRQPGSASALGYPRHCPRHCPREACANKPGHPT
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: C9orf144B, family with sequence similarity 205, member A, RP11-195F19.10
Gene Symbols: FAM205A
Isotype: IgG
Purification Method: Affinity Purified