ADAMTS5 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ADAMTS5
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
GPCR
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
11096
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SHDDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQILGPEELPGQTYDATQQ
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
A disintegrin and metalloproteinase with thrombospondin motifs 11, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 5 (aggrecanase-2), ADAM metallopeptidase with thrombospondin type 1 motif, 5, ADAM-TS 11, ADAM-TS 5, ADAMTS-11, ADAM-TS5, ADAMTS-5, ADMP2, ADMP-2A disintegrin and metalloproteinase with thrombospondin motifs 5, Aggrecanase-2, disintegrin-like and metalloprotease with thrombospondin type 1 motif, 510ADAMTS11FLJ36738, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.14, EC 3.4.24.82
Gene Symbols
ADAMTS5
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- ADAMTS5 Polyclonal specifically detects ADAMTS5 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ADAMTS5
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: GPCR
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 11096
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SHDDSKFCEETFGSTEDKRLMSSILTSIDASKPWSKCTSATITEFLDDGHGNCLLDLPRKQILGPEELPGQTYDATQQ
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: A disintegrin and metalloproteinase with thrombospondin motifs 11, a disintegrin-like and metalloprotease (reprolysin type) with thrombospondintype 1 motif, 5 (aggrecanase-2), ADAM metallopeptidase with thrombospondin type 1 motif, 5, ADAM-TS 11, ADAM-TS 5, ADAMTS-11, ADAM-TS5, ADAMTS-5, ADMP2, ADMP-2A disintegrin and metalloproteinase with thrombospondin motifs 5, Aggrecanase-2, disintegrin-like and metalloprotease with thrombospondin type 1 motif, 510ADAMTS11FLJ36738, EC 3.4.24, EC 3.4.24.-, EC 3.4.24.14, EC 3.4.24.82
Gene Symbols: ADAMTS5
Isotype: IgG
Purification Method: Affinity Purified
Antigen: BEX4
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 56271
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESKEELAANNLNGENAQQENEGGEQAPTQNEEESRHLGGGEGQKPGGNIRRGRVRRLVPN
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: BEX family member 4, BEX1-like protein 1, BEXL1, brain expressed X-linked-like 1, brain expressed, X-linked 4, Brain-expressed X-linked protein 4, FLJ10097, NADE3, Nerve growth factor receptor-associated protein 3, protein BEX4
Gene Symbols: BEX4
Isotype: IgG
Purification Method: Affinity Purified
Antigen: MMS19 like protein
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 64210
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LVFMALTDPSTQLQLVGIRTLTVLGAQPDLLSYEDLELAVGHLYRLSFLKEDSQSCRVAALEASGTLAALYPVAFSSHLVPKLA
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: FLJ34167, MET18, MET18 homolog, MMS19 nucleotide excision repair homolog (S. cerevisiae), S. cerevisiae)
Gene Symbols: MMS19
Isotype: IgG
Purification Method: Affinity Purified
