RelA/NFkB p65 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
RelA/NFkB p65
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Apoptosis, Cancer, Cell Biology, Immune System Diseases, Immunology, Innate Immunity, Neurodegeneration, Neuroscience, Signal Transduction, Transcription Factors and Regulators
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
5970
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
MGC131774, nf kb p65, NFkB p65, NF-kB p65, NFKB3v-rel avian reticuloendotheliosis viral oncogene homolog A (nuclear factor ofkappa light polypeptide gene enhancer in B-cells 3 (p65)), Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3transcription factor p65, p65, RelA, rela p65, v-rel reticuloendotheliosis viral oncogene homolog A (avian), v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappalight polypeptide gene enhancer in B-cells 3, p65
Gene Symbols
RELA
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- RelA/NFkB p65 Polyclonal specifically detects RelA/NFkB p65 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: RelA/NFkB p65
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Apoptosis, Cancer, Cell Biology, Immune System Diseases, Immunology, Innate Immunity, Neurodegeneration, Neuroscience, Signal Transduction, Transcription Factors and Regulators
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 5970
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GIQCVKKRDLEQAISQRIQTNNNPFQVPIEEQRGDYDLNAVRLC
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: MGC131774, nf kb p65, NFkB p65, NF-kB p65, NFKB3v-rel avian reticuloendotheliosis viral oncogene homolog A (nuclear factor ofkappa light polypeptide gene enhancer in B-cells 3 (p65)), Nuclear factor NF-kappa-B p65 subunit, Nuclear factor of kappa light polypeptide gene enhancer in B-cells 3transcription factor p65, p65, RelA, rela p65, v-rel reticuloendotheliosis viral oncogene homolog A (avian), v-rel reticuloendotheliosis viral oncogene homolog A, nuclear factor of kappalight polypeptide gene enhancer in B-cells 3, p65
Gene Symbols: RELA
Isotype: IgG
Purification Method: Affinity Purified
Antigen: PLEKHG3
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 26030
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:DSLSCQLSPEVDISVGVATEDSPSVNGMEPPSPGCPVEPDRSSCKKKESALSTRDRLLLDKIKSYYENAEHHD
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: ARHGEF43, KIAA0599, PH Domain-Containing Family G Member 3, Pleckstrin Homology And RhoGEF Domain Containing G3, Pleckstrin Homology Domain Containing, Family G, Member 3, Pleckstrin Homology Domain-Containing Family G Member 3
Gene Symbols: PLEKHG3
Isotype: IgG
Purification Method: Affinity Purified
Antigen: DELGEF
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 26297
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SLFGCPIQQVACGWDFTIMLTENGQVLSCGSNSFGQLGVPHGPRRCVVPQAIELHKEKVVCIAAGLRHAVAATASGIVFQW
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: Deafness locus-associated putative guanine nucleotide exchange factor, DelGEF, DELGEFdeafness locus associated putative guanine nucleotide exchange factor, Gnefr, Guanine nucleotide exchange factor-related protein, secretion regulating guanine nucleotide exchange factor, secretion-regulating guanine nucleotide exchange factor
Gene Symbols: SERGEF
Isotype: IgG
Purification Method: Affinity Purified