AP1M2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
AP1M2
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Alias
Adaptor protein complex AP-1 mu-2 subunit, Adaptor-related protein complex 1 mu-2 subunit, adaptor-related protein complex 1, mu 2 subunit, AP-1 complex subunit mu-2, AP1-mu2, AP-mu chain family member mu1B, Clathrin assembly protein complex 1 medium chain 2, clathrin coat assembly protein AP47 2, clathrin coat associated protein AP47 2, clathrin-associated adaptor medium chain mu2, golgi adaptor AP-1 47 kDa protein, Golgi adaptor HA1/AP1 adaptin mu-2 subunit, HA1 47 kDa subunit 2, HSMU1B, MU1B, MU-1B, mu1B-adaptin, mu2, Mu-adaptin 2
Gene Symbols
AP1M2
Isotype
IgG
Purification Method
Affinity Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
10053
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MPLLVQREEEGALAPLLSHGQVHFLWI
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- AP1M2 Polyclonal specifically detects AP1M2 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: AP1M2
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: Adaptor protein complex AP-1 mu-2 subunit, Adaptor-related protein complex 1 mu-2 subunit, adaptor-related protein complex 1, mu 2 subunit, AP-1 complex subunit mu-2, AP1-mu2, AP-mu chain family member mu1B, Clathrin assembly protein complex 1 medium chain 2, clathrin coat assembly protein AP47 2, clathrin coat associated protein AP47 2, clathrin-associated adaptor medium chain mu2, golgi adaptor AP-1 47 kDa protein, Golgi adaptor HA1/AP1 adaptin mu-2 subunit, HA1 47 kDa subunit 2, HSMU1B, MU1B, MU-1B, mu1B-adaptin, mu2, Mu-adaptin 2
Gene Symbols: AP1M2
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 10053
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MPLLVQREEEGALAPLLSHGQVHFLWI
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: VSIG10L
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: V-Set And Immunoglobulin Domain Containing 10 Like, V-Set And Immunoglobulin Domain-Containing Protein 10-Like
Gene Symbols: VSIG10L
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 147645
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PSFTVKTPASNISTQVSHTKLSVEAPDSKFSPDDMDLKLSAQSPESKFSAETHSAASFPQQVGGPLAVLVGTTIRLPLVPIPNP
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: Rab3C
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: RAB3C, member RAS oncogene family, ras-related protein Rab-3C
Gene Symbols: RAB3C
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 115827
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESLETDPAITAAKQNTRLKETPPPPQPNCAC
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
