csl/RBPJK Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
csl/RBPJK
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Alias
CBF-1, csl, H-2K binding factor-2, IGKJRB1RBPSUHCBF1, IGKJRBRBP-J kappa, immunoglobulin kappa J region recombination signal binding protein 1, J kappa-recombination signal-binding protein, KBF2, RBP-JK, RBPJKMGC61669, RBP-Jrecombining binding protein suppressor of hairless (Drosophila), recombination signal binding protein for immunoglobulin kappa J region, recombining binding protein suppressor of hairless, Renal carcinoma antigen NY-REN-30, SUH, suppressor of hairless homolog
Gene Symbols
RBPJ
Isotype
IgG
Purification Method
Affinity Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
3516
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- csl/RBPJK Polyclonal specifically detects csl/RBPJK in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: csl/RBPJK
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: CBF-1, csl, H-2K binding factor-2, IGKJRB1RBPSUHCBF1, IGKJRBRBP-J kappa, immunoglobulin kappa J region recombination signal binding protein 1, J kappa-recombination signal-binding protein, KBF2, RBP-JK, RBPJKMGC61669, RBP-Jrecombining binding protein suppressor of hairless (Drosophila), recombination signal binding protein for immunoglobulin kappa J region, recombining binding protein suppressor of hairless, Renal carcinoma antigen NY-REN-30, SUH, suppressor of hairless homolog
Gene Symbols: RBPJ
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 3516
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SAFREGWRWVRQPVQVPVTLVRNDGIIYSTSLTFTYTPEPGPRPHCSAAGAILRANSSQVPPNESNTNSEGSYTNASTNSTSVTSSTATVVS
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: Claspin
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: claspin, claspin homolog, claspin homolog (Xenopus laevis), hClaspin, MGC131612, MGC131613, MGC131615
Gene Symbols: CLSPN
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 63967
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SFVILEPETNRELEALKQRFWKHANPAAKPRAGQTVNVNVIVKDMGTDGKEELKADVVPVTLAPKKLDGASHTKPGEKLQVLKAKLQEAMKLRR
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: Claspin
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: claspin, claspin homolog, claspin homolog (Xenopus laevis), hClaspin, MGC131612, MGC131613, MGC131615
Gene Symbols: CLSPN
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 63967
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VPKSLSSDSTLLLFKDSSSKMGYFPTEEKSETDENSGKQPSKLDEDDSCSLLTKESSHNSSFELIGSTIPSYQP
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
