ATP6V1A Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ATP6V1A
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human, Canine
Gene Alias
70kD, isoform 1, ATP6A1, ATP6V1A1ATPase, H+ transporting, lysosomal, subunit A1, ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha polypeptide, ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A, EC 3.6.3, EC 3.6.3.14, H(+)-transporting two-sector ATPase, subunit A, H+-transporting ATPase chain A, vacuolar (VA68 type), HO68, VA68, vacuolar ATP synthase catalytic subunit A, ubiquitous isoform, Vacuolar ATPase isoform VA68, vacuolar proton pump alpha subunit 1, Vacuolar proton pump subunit alpha, V-ATPase 69 kDa subunit, V-ATPase 69 kDa subunit 1, V-ATPase A subunit 1, V-ATPase subunit A, Vma1, VPP2, V-type proton ATPase catalytic subunit A
Gene Symbols
ATP6V1A
Isotype
IgG
Purification Method
Affinity Purified
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
523
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQT
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- ATP6V1A Polyclonal antibody specifically detects ATP6V1A in Human, Canine samples
- It is validated for Western Blot, Immunocytochemistry, Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ATP6V1A
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human, Canine
Gene Alias: 70kD, isoform 1, ATP6A1, ATP6V1A1ATPase, H+ transporting, lysosomal, subunit A1, ATPase, H+ transporting, lysosomal (vacuolar proton pump), alpha polypeptide, ATPase, H+ transporting, lysosomal 70kDa, V1 subunit A, EC 3.6.3, EC 3.6.3.14, H(+)-transporting two-sector ATPase, subunit A, H+-transporting ATPase chain A, vacuolar (VA68 type), HO68, VA68, vacuolar ATP synthase catalytic subunit A, ubiquitous isoform, Vacuolar ATPase isoform VA68, vacuolar proton pump alpha subunit 1, Vacuolar proton pump subunit alpha, V-ATPase 69 kDa subunit, V-ATPase 69 kDa subunit 1, V-ATPase A subunit 1, V-ATPase subunit A, Vma1, VPP2, V-type proton ATPase catalytic subunit A
Gene Symbols: ATP6V1A
Isotype: IgG
Purification Method: Affinity Purified
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 523
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YVHGVSGPVVTACDMAGAAMYELVRVGHSELVGEIIRLEGDMATIQVYEETSGVSVGDPVLRTGKPLSVELGPGIMGAIFDGIQRPLSDISSQT
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: RBBP9
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: B5T-overexpressed gene protein, Bog, BOGB5T overexpressed gene protein, EC 3.-, Protein BOG, putative hydrolase RBBP9, RBBP10, RBBP-10, RBBP-9, retinoblastoma binding protein 9, Retinoblastoma-binding protein 10, Retinoblastoma-binding protein 9MGC9236, retinoma-binding protein 9
Gene Symbols: RBBP9
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 10741
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PWQWEKIKANCPYIVQFGSTDDPFLPWKEQQEVADRLETKLHKFTDCGHFQNTEFHELITVVKSLLKVPA
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: Muscleblind-like 1
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: DKFZp686P06174, EXP40, EXP42, EXPKIAA0428EXP35, MBNL, muscleblind (Drosophila)-like, muscleblind-like (Drosophila), muscleblind-like protein 1, Triplet-expansion RNA-binding protein
Gene Symbols: MBNL1
Isotype: IgG
Purification Method: Affinity Purified
Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 4154
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KNMAMLAQQMQLANAMMPGAPLQPVPMFSVAPSLATNASAAAFNPYLGPVSPSLVPAEILPTAPMLVTGNPGVPVPA
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.