ISG15 Activating Enzyme/UBE1L Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ISG15 Activating Enzyme/UBE1L
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Alias
D8UBA1, ubiquitin-activating enzyme E1 homolog B, UBA1B, UBA7, ubiquitin-activating enzyme E1, UBE1L, UBE2MGC12713, Ubiquitin-activating enzyme 7, Ubiquitin-activating enzyme E1 homolog, ubiquitin-activating enzyme E1-like, ubiquitin-activating enzyme E1-related protein, ubiquitin-activating enzyme-2, ubiquitin-like modifier activating enzyme 7, ubiquitin-like modifier-activating enzyme 7
Gene Symbols
UBA7
Isotype
IgG
Purification Method
Affinity Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
7318
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKR
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- ISG15 Activating Enzyme/UBE1L Polyclonal specifically detects ISG15 Activating Enzyme/UBE1L in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ISG15 Activating Enzyme/UBE1L
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: D8UBA1, ubiquitin-activating enzyme E1 homolog B, UBA1B, UBA7, ubiquitin-activating enzyme E1, UBE1L, UBE2MGC12713, Ubiquitin-activating enzyme 7, Ubiquitin-activating enzyme E1 homolog, ubiquitin-activating enzyme E1-like, ubiquitin-activating enzyme E1-related protein, ubiquitin-activating enzyme-2, ubiquitin-like modifier activating enzyme 7, ubiquitin-like modifier-activating enzyme 7
Gene Symbols: UBA7
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 7318
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EVKRPKTVRHKSLDTALLQPHVVAQSSQEVHHAHCLHQAFCALHKFQHLHGRPPQPWDPVDAETVVGLARDLEPLKR
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: GNA11
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: G alpha-11, GA11, GNA-11, G-protein subunit alpha-11, guanine nucleotide binding protein (G protein), alpha 11 (Gq class), Guanine nucleotide-binding protein G(y) subunit alpha, guanine nucleotide-binding protein subunit alpha-11, guanine nucleotide-binding protein, Gq class, GNA11
Gene Symbols: GNA11
Isotype: IgG
Purification Method: Immunogen affinity purified
Applications: Western Blot, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 2767
Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:SDNENRMEESKALFRTIITYPWFQNS
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: GNA11
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: G alpha-11, GA11, GNA-11, G-protein subunit alpha-11, guanine nucleotide binding protein (G protein), alpha 11 (Gq class), Guanine nucleotide-binding protein G(y) subunit alpha, guanine nucleotide-binding protein subunit alpha-11, guanine nucleotide-binding protein, Gq class, GNA11
Gene Symbols: GNA11
Isotype: IgG
Purification Method: Immunogen affinity purified
Applications: Western Blot, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 2767
Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:SDNENRMEESKALFRTIITYPWFQNS
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
