ABCG1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ABCG1
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
ABC Transporters, Cancer, Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
9619
Immunogen
This antibody was developed against a Recombinant Protein corresponding to amino acids:EYGDQNSRLVRAVREGMCDSDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Western Blot, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
ABC transporter 8, ABC8ATP-binding cassette sub-family G member 1, ATP-binding cassette transporter 8, ATP-binding cassette, sub-family G (WHITE), member 1, homolog of Drosophila white, MGC34313, White protein homolog, white protein homolog (ATP-binding cassette transporter 8), 10ATP-binding cassette transporter member 1 of subfamily G, WHITE1, WHT1
Gene Symbols
ABCG1
Isotype
IgG
Purification Method
Immunogen affinity purified
Related Products
Description
- ABCG1 Polyclonal specifically detects ABCG1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ABCG1
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: ABC Transporters, Cancer, Cholesterol Metabolism, Lipid and Metabolism, Signal Transduction
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 9619
Immunogen: This antibody was developed against a Recombinant Protein corresponding to amino acids:EYGDQNSRLVRAVREGMCDSDHKRDLGGDAEVNPFLWHRPSEEVKQTKRLKGLRKDSSSMEGCHSFSASCL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Western Blot, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: ABC transporter 8, ABC8ATP-binding cassette sub-family G member 1, ATP-binding cassette transporter 8, ATP-binding cassette, sub-family G (WHITE), member 1, homolog of Drosophila white, MGC34313, White protein homolog, white protein homolog (ATP-binding cassette transporter 8), 10ATP-binding cassette transporter member 1 of subfamily G, WHITE1, WHT1
Gene Symbols: ABCG1
Isotype: IgG
Purification Method: Immunogen affinity purified
Antigen: HPV18 E6
Classification: Monoclonal
Host Species: Mouse
Research Discipline: Cancer, Tumor Suppressors
Formulation: PBS with 0.02% Sodium Azide
Gene ID (Entrez): __
Immunogen: HPV18E6-beta-galactosidase fusion protein synthesized in E. coli
Primary or Secondary: Primary
Test Specificity: __
Applications: Western Blot, ELISA, Immunoprecipitation
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Virus
Gene Alias: E6, HpV18gp1, Human papillomavirus type 18 E6, Protein E6
Gene Symbols: __
Isotype: IgG
Purification Method: Protein A purified
Antigen: HPV18 E6
Classification: Monoclonal
Host Species: Mouse
Research Discipline: Cancer, Tumor Suppressors
Formulation: PBS with 0.02% Sodium Azide
Gene ID (Entrez): __
Immunogen: HPV18E6-beta-galactosidase fusion protein synthesized in E. coli
Primary or Secondary: Primary
Test Specificity: __
Applications: Western Blot, ELISA, Immunoprecipitation
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Virus
Gene Alias: E6, HpV18gp1, Human papillomavirus type 18 E6, Protein E6
Gene Symbols: __
Isotype: IgG
Purification Method: Protein A purified
