FAPP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
FAPP2
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Alias
DKFZp313M1034, DKFZp686J09164, FAPP-2, FAPP2MGC3358, hFAPP2, PH domain-containing family A member 8, Phosphatidylinositol-four-phosphate adapter protein 2, Phosphoinositol 4-phosphate adapter protein 2, pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 8, pleckstrin homology domain-containing family A member 8, Serologically defined breast cancer antigen NY-BR-86
Gene Symbols
PLEKHA8
Isotype
IgG
Purification Method
Affinity Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
84725
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSELLYRTPPGSPQLAMLKSSKMKHPIIPIHNSLERQMELSTCENGSLNMEINGEEEILMKNKNSLYLKSAEIDCSISSEENTDDNITVQGEIMK
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- FAPP2 Polyclonal specifically detects FAPP2 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: FAPP2
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: DKFZp313M1034, DKFZp686J09164, FAPP-2, FAPP2MGC3358, hFAPP2, PH domain-containing family A member 8, Phosphatidylinositol-four-phosphate adapter protein 2, Phosphoinositol 4-phosphate adapter protein 2, pleckstrin homology domain containing, family A (phosphoinositide bindingspecific) member 8, pleckstrin homology domain-containing family A member 8, Serologically defined breast cancer antigen NY-BR-86
Gene Symbols: PLEKHA8
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 84725
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TSELLYRTPPGSPQLAMLKSSKMKHPIIPIHNSLERQMELSTCENGSLNMEINGEEEILMKNKNSLYLKSAEIDCSISSEENTDDNITVQGEIMK
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: Histone H3
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: H3, H3 histone, family 3A, H3.3A, H3.3B, H3F2, H3F3, H3F3B, H3FM, HIST2H3C, histone H3.3, MGC87782, MGC87783
Gene Symbols: H3C14
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 126961
Immunogen: This Histone H3 antibody was developed against a Recombinant Protein corresponding to amino acids: SEAYLVGLFEDTNLCAIHAKRVTIM
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: Histone H3
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: H3, H3 histone, family 3A, H3.3A, H3.3B, H3F2, H3F3, H3F3B, H3FM, HIST2H3C, histone H3.3, MGC87782, MGC87783
Gene Symbols: H3C14
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 126961
Immunogen: This Histone H3 antibody was developed against a Recombinant Protein corresponding to amino acids: SEAYLVGLFEDTNLCAIHAKRVTIM
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
