ATRX Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ATRX
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Cancer, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
546
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
alpha thalassemia/mental retardation syndrome X-linked, alpha thalassemia/mental retardation syndrome X-linked (RAD54 (S. cerevisiae)homolog), alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S.cerevisiae), ATP-dependent helicase ATRX, ATR2, DNA dependent ATPase and helicase, EC 3.6.1, EC 3.6.4.12, helicase 2, X-linked, Juberg-Marsidi syndrome, MGC2094, MRXHF1, RAD54 homolog, RAD54L, SFM1, SHS, transcriptional regulator ATRX, XH2RAD54, X-linked helicase II, X-linked nuclear protein, XNPZNF-HX, Zinc finger helicase, Znf-HX
Gene Symbols
ATRX
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- ATRX Polyclonal specifically detects ATRX in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ATRX
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Cancer, Checkpoint signaling, DNA Double Strand Break Repair, DNA Repair
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 546
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EFRAMDAVNKEKNTKEHKVIDAKFETKARKGEKPCALEKKDISKSEAKLSRKQVDSEHMHQNVPTEEQRTNKSTGGEHKKSDRKEEPQYEPANTSE
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: alpha thalassemia/mental retardation syndrome X-linked, alpha thalassemia/mental retardation syndrome X-linked (RAD54 (S. cerevisiae)homolog), alpha thalassemia/mental retardation syndrome X-linked (RAD54 homolog, S.cerevisiae), ATP-dependent helicase ATRX, ATR2, DNA dependent ATPase and helicase, EC 3.6.1, EC 3.6.4.12, helicase 2, X-linked, Juberg-Marsidi syndrome, MGC2094, MRXHF1, RAD54 homolog, RAD54L, SFM1, SHS, transcriptional regulator ATRX, XH2RAD54, X-linked helicase II, X-linked nuclear protein, XNPZNF-HX, Zinc finger helicase, Znf-HX
Gene Symbols: ATRX
Isotype: IgG
Purification Method: Affinity Purified
Antigen: Frizzled-7
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: GPCR, Growth and Development, Neuronal Cell Markers, Signal Transduction, Wnt Signaling Pathway
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 8324
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTAL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: frizzled (Drosophila) homolog 7, frizzled homolog 7 (Drosophila), Frizzled, drosophila, homolog of, 7, Fz-7, FzE3frizzled-7, hFz7
Gene Symbols: FZD7
Isotype: IgG
Purification Method: Affinity Purified
Antigen: Frizzled-7
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: GPCR, Growth and Development, Neuronal Cell Markers, Signal Transduction, Wnt Signaling Pathway
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 8324
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:CVGQNTSDGSGGPGGGPTAYPTAPYLPDLPFTAL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: frizzled (Drosophila) homolog 7, frizzled homolog 7 (Drosophila), Frizzled, drosophila, homolog of, 7, Fz-7, FzE3frizzled-7, hFz7
Gene Symbols: FZD7
Isotype: IgG
Purification Method: Affinity Purified
