SRRM2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody has been used in 1 publication
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
SRRM2
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Alias
Cwc21, CWF21, DKFZp667L0421,300 kDa nuclear matrix antigen, DKFZp686O15166,300-KD, FLJ21926, FLJ22250, HSPC075, KIAA0324, MGC40295, RNA binding protein, ser/Arg-related nuclear matrix protein of 300 kDa, serine/arginine repetitive matrix 2, serine/arginine repetitive matrix protein 2, serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa, splicing coactivator subunit SRm300, SRL300, SRm300, SR-related nuclear matrix protein of 300 kDa, taxREB803, tax-responsive enhancer element-binding protein 803
Gene Symbols
SRRM2
Isotype
IgG
Purification Method
Affinity Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
23524
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LMLLEKDVNPGGKEETPGQRPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREAKQPAPEP
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- SRRM2 Polyclonal specifically detects SRRM2 in Human, Mouse samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: SRRM2
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: Cwc21, CWF21, DKFZp667L0421,300 kDa nuclear matrix antigen, DKFZp686O15166,300-KD, FLJ21926, FLJ22250, HSPC075, KIAA0324, MGC40295, RNA binding protein, ser/Arg-related nuclear matrix protein of 300 kDa, serine/arginine repetitive matrix 2, serine/arginine repetitive matrix protein 2, serine/arginine-rich splicing factor-related nuclear matrix protein of 300 kDa, splicing coactivator subunit SRm300, SRL300, SRm300, SR-related nuclear matrix protein of 300 kDa, taxREB803, tax-responsive enhancer element-binding protein 803
Gene Symbols: SRRM2
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 23524
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LMLLEKDVNPGGKEETPGQRPAVTETHQLAELNEKKNERLRAAFGISDSYVDGSSFDPQRRAREAKQPAPEP
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: SPIN1
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: OCR, spindlin, spindlin 1, spindlin-1, SPINOvarian cancer-related protein
Gene Symbols: SPIN1
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 10927
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MKTPFGKTPGQRSRADAGHAGVSANMMKKRTSHKKHRSSVGPSKPVSQPRRNI
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: FAM133A
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: Cancer/Testis Antigen 115, CT115, Family With Sequence Similarity 133 Member A, Family With Sequence Similarity 133, Member A, Protein FAM133A
Gene Symbols: FAM133A
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 286499
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KALAEFEEKMNENWKKELEKSREKLLSG
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
