KNOP1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
KNOP1
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Alias
C16orf88, Chromosome 16 Open Reading Frame 88, FAM191A, Family With Sequence Similarity 191, Member A, Lysine-Rich Nucleolar Protein 1, Protein C16orf88, Protein FAM191A, Testis-Specific Gene 118, Testis-Specific Gene 118 Protein, TSG118
Gene Symbols
KNOP1
Isotype
IgG
Purification Method
Affinity Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
400506
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KKKRKESGVAGDPWKEETDTDLEVVLEKKGNMDEAHIDQVRRKALQEEIDRESGKTEASETRKWTGTQFGQWDT
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- KNOP1 Polyclonal specifically detects KNOP1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: KNOP1
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: C16orf88, Chromosome 16 Open Reading Frame 88, FAM191A, Family With Sequence Similarity 191, Member A, Lysine-Rich Nucleolar Protein 1, Protein C16orf88, Protein FAM191A, Testis-Specific Gene 118, Testis-Specific Gene 118 Protein, TSG118
Gene Symbols: KNOP1
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 400506
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KKKRKESGVAGDPWKEETDTDLEVVLEKKGNMDEAHIDQVRRKALQEEIDRESGKTEASETRKWTGTQFGQWDT
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: JMJD1C
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: DKFZp761F0118, EC 1.14.11, EC 1.14.11.-, FLJ14374, JHDM2C, jumonji domain containing 1C, Jumonji domain-containing protein 1C, KIAA1380TR-interacting protein 8, probable JmjC domain-containing histone demethylation protein 2C, RP11-10C13.2, thyroid hormone receptor interactor 8, thyroid receptor interacting protein 8, Thyroid receptor-interacting protein 8, TRIP8, TRIP-8
Gene Symbols: JMJD1C
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 221037
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:IIPGSVLTDLLDAMHTLREKYGIKSHCHCTNKQNLQVGNFPTMNGVSQVLQNVLNHSNKISLCMPESQQQNTPPKS
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: __
Classification: __
Host Species: __
Target Species: __
Gene Alias: __
Gene Symbols: __
Isotype: __
Purification Method: __
Applications: __
Conjugate: __
Regulatory Status: __
Formulation: __
Gene ID (Entrez): __
Immunogen: __
Primary or Secondary: __
Test Specificity: __
