Protein Disulfide Isomerase/P4HB Antibody - BSA Free, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
Protein Disulfide Isomerase/P4HB
Applications
Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human, Mouse, Rat
Gene Alias
Cellular thyroid hormone-binding protein, collagen prolyl 4-hydroxylase beta, DSI, ERBA2L, GIT, glutathione-insulin transhydrogenase, P4Hbeta, p55, PDIA1procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide (protein disulfide isomerase-associated 1), PDIEC 5.3.4.1, PHDB, PO4DB, PO4HB, procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide, PROHBprocollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide (protein disulfide isomerase; thyroid hormone binding protein p55), Prolyl 4-hydroxylase subunit beta, prolyl 4-hydroxylase, beta polypeptide, protein disulfide isomerase family A, member 1, protein disulfide isomerase/oxidoreductase, protein disulfide isomerase-associated 1, protein disulfide-isomerase, protocollagen hydroxylase, thyroid hormone-binding protein p55
Gene Symbols
P4HB
Isotype
IgG
Purification Method
Affinity Purified
Molecular Weight of Antigen
54 kDa
Concentration
1 mg/mL
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Cellular Markers, ER Markers, Fibroblast Cell Markers, Hypoxia
Formulation
PBS with 0.02% Sodium Azide
Gene ID (Entrez)
5034
Immunogen
Antibody was raised against a 17 amino acid peptide near the center of human Protein Disulfide Isomerase/P4HB. The immunogen is located within amino acids 190 - 240 of Protein Disulfide Isomerase/P4HB. Amino Acid Squence: FKKFDEGRNNFEGEVTK
Primary or Secondary
Primary
Test Specificity
PDIA1 antibody is human, mouse and rat reactive.
Related Products
Description
- Protein Disulfide Isomerase/P4HB Polyclonal specifically detects Protein Disulfide Isomerase/P4HB in Human, Mouse, Rat samples
- It is validated for Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: Protein Disulfide Isomerase/P4HB
Applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: Cellular thyroid hormone-binding protein, collagen prolyl 4-hydroxylase beta, DSI, ERBA2L, GIT, glutathione-insulin transhydrogenase, P4Hbeta, p55, PDIA1procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide (protein disulfide isomerase-associated 1), PDIEC 5.3.4.1, PHDB, PO4DB, PO4HB, procollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide, PROHBprocollagen-proline, 2-oxoglutarate 4-dioxygenase (proline 4-hydroxylase), betapolypeptide (protein disulfide isomerase; thyroid hormone binding protein p55), Prolyl 4-hydroxylase subunit beta, prolyl 4-hydroxylase, beta polypeptide, protein disulfide isomerase family A, member 1, protein disulfide isomerase/oxidoreductase, protein disulfide isomerase-associated 1, protein disulfide-isomerase, protocollagen hydroxylase, thyroid hormone-binding protein p55
Gene Symbols: P4HB
Isotype: IgG
Purification Method: Affinity Purified
Molecular Weight of Antigen: 54 kDa
Concentration: 1 mg/mL
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Cellular Markers, ER Markers, Fibroblast Cell Markers, Hypoxia
Formulation: PBS with 0.02% Sodium Azide
Gene ID (Entrez): 5034
Immunogen: Antibody was raised against a 17 amino acid peptide near the center of human Protein Disulfide Isomerase/P4HB. The immunogen is located within amino acids 190 - 240 of Protein Disulfide Isomerase/P4HB. Amino Acid Squence: FKKFDEGRNNFEGEVTK
Primary or Secondary: Primary
Test Specificity: PDIA1 antibody is human, mouse and rat reactive.
Antigen: PPM1H
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: ARHCL1, FLJ13253, KIAA1157, member C like 1, NERPP-2C, neurite extension-related protein phosphatase related to PP2C, protein phosphatase 1H, protein phosphatase 1H (PP2C domain containing), protein phosphatase, Mg2+/Mn2+ dependent, 1H, URCC2
Gene Symbols: PPM1H
Isotype: IgG
Purification Method: Affinity Purified
Molecular Weight of Antigen: __
Concentration: __
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 57460
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: MAGSSGSEHGGGSCGGSDLPLRFPYGRPEFLGLSQDEVECSADHIARPILILKETRR
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: MAGEA4
Applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunocytochemistry
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human, Mouse, Rat
Gene Alias: MAGE-X2 antigen, melanoma antigen family A, 4, melanoma-associated antigen 4, member 4
Gene Symbols: MAGEA4
Isotype: IgG
Purification Method: Affinity Purified
Molecular Weight of Antigen: 45 kDa
Concentration: 1 mg/mL
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Cancer
Formulation: PBS with 0.02% Sodium Azide
Gene ID (Entrez): 4103
Immunogen: MAGEA4 antibody was raised against a 16 amino acid peptide near the amino terminus of human MAGEA4. The immunogen is located within the first 50 amino acids of MAGEA4. Amino Acid Squence: VGAQAPTTEEQEAAVS
Primary or Secondary: Primary
Test Specificity: MAGEA4 antibody is human specific. At least four isoforms of MAGEA4 are known to exist.