NUDT15 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
NUDT15
Applications
Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias
8-oxo-dGTPase NUDT15, A730068G11Rik, EC 3.1.6.-, FLJ10956, MTH2MGC104352, MutT homolog 2, Nucleoside diphosphate-linked moiety X motif 15, nudix (nucleoside diphosphate linked moiety X)-type motif 15, Nudix motif 15, nudix-type motif 15, probable 7,8-dihydro-8-oxoguanine triphosphatase NUDT15, RP11-90M2.1
Gene Symbols
NUDT15
Isotype
IgG
Purification Method
Affinity Purified
Dilution
Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Accession No.
Q9NV35
Gene ID (Entrez)
55270
Immunogen
This antibody was developed against a recombinant protein corresponding to amino acids: EKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEELPPLDQLFWGLRCLKEQGYDPFKEDLNHLVGYKGNHL
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- NUDT15 Polyclonal specifically detects NUDT15 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: NUDT15
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS (pH 7.2) and 40% Glycerol with 0.02% Sodium Azide
Gene Alias: 8-oxo-dGTPase NUDT15, A730068G11Rik, EC 3.1.6.-, FLJ10956, MTH2MGC104352, MutT homolog 2, Nucleoside diphosphate-linked moiety X motif 15, nudix (nucleoside diphosphate linked moiety X)-type motif 15, Nudix motif 15, nudix-type motif 15, probable 7,8-dihydro-8-oxoguanine triphosphatase NUDT15, RP11-90M2.1
Gene Symbols: NUDT15
Isotype: IgG
Purification Method: Affinity Purified
Dilution: Immunohistochemistry, Immunohistochemistry-Paraffin 1:1000 - 1:2500
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Accession No.: Q9NV35
Gene ID (Entrez): 55270
Immunogen: This antibody was developed against a recombinant protein corresponding to amino acids: EKENYHYVTILMKGEVDVTHDSEPKNVEPEKNESWEWVPWEELPPLDQLFWGLRCLKEQGYDPFKEDLNHLVGYKGNHL
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: TMEM106A
Applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS with 0.02% Sodium Azide
Gene Alias: Transmembrane Protein 106A
Gene Symbols: TMEM106A
Isotype: IgG
Purification Method: Affinity Purified
Dilution: __
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human, Mouse
Gene Accession No.: __
Gene ID (Entrez): 113277
Immunogen: Antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of human TMEM106A. The immunogen is located within the first 50 amino acids of TMEM106A. Amino Acid Squence: KAVNYSSTGSSKSF
Primary or Secondary: Primary
Test Specificity: __
Antigen: TMEM106A
Applications: Western Blot, ELISA, Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS with 0.02% Sodium Azide
Gene Alias: Transmembrane Protein 106A
Gene Symbols: TMEM106A
Isotype: IgG
Purification Method: Affinity Purified
Dilution: __
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human, Mouse
Gene Accession No.: __
Gene ID (Entrez): 113277
Immunogen: Antibody was raised against a 14 amino acid synthetic peptide near the amino terminus of human TMEM106A. The immunogen is located within the first 50 amino acids of TMEM106A. Amino Acid Squence: KAVNYSSTGSSKSF
Primary or Secondary: Primary
Test Specificity: __