FBXW11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
FBXW11
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Signal Transduction, Wnt Signaling Pathway
Gene Alias
beta-transducin repeat-containing protein 2, BTRC2F-box/WD repeat-containing protein 1B, BTRCP2FBW1B, F-box and WD repeat domain containing 11, F-box and WD-40 domain protein 11, F-box and WD-40 domain protein 1B, F-box protein Fbw1b, F-box/WD repeat-containing protein 11, Fbw11, FBXW1BFbw1b, Homologous to Slimb protein, Hos, KIAA0696F-box and WD repeats protein beta-TrCP2
Gene Symbols
FBXW11
Isotype
IgG
Purification Method
Affinity Purified
Dilution
Immunohistochemistry-Paraffin 1:500 - 1:1000
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene ID (Entrez)
23291
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEPDSVIEDKTIELMCSVPR
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- FBXW11 Polyclonal specifically detects FBXW11 in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: FBXW11
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Signal Transduction, Wnt Signaling Pathway
Gene Alias: beta-transducin repeat-containing protein 2, BTRC2F-box/WD repeat-containing protein 1B, BTRCP2FBW1B, F-box and WD repeat domain containing 11, F-box and WD-40 domain protein 11, F-box and WD-40 domain protein 1B, F-box protein Fbw1b, F-box/WD repeat-containing protein 11, Fbw11, FBXW1BFbw1b, Homologous to Slimb protein, Hos, KIAA0696F-box and WD repeats protein beta-TrCP2
Gene Symbols: FBXW11
Isotype: IgG
Purification Method: Affinity Purified
Dilution: Immunohistochemistry-Paraffin 1:500 - 1:1000
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 23291
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MEPDSVIEDKTIELMCSVPR
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: KRT34
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: Ha-4, HA4, Hair keratin, type I Ha4, HHA4, HKA4, K34, keratin 34, keratin, hair, acidic, 4, keratin, type I cuticular Ha4, keratin-34, KRTHA4hard keratin, type I, 4
Gene Symbols: KRT34
Isotype: IgG
Purification Method: Affinity Purified
Dilution: __
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 3885
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATTNASGNSCGPCGTSQKGCCN
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: ZDHHC22
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: putative palmitoyltransferase ZDHHC22, C14orf59, zinc finger, DHHC-type containing 22
Gene Symbols: ZDHHC22
Isotype: IgG
Purification Method: Affinity Purified
Dilution: __
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 283576
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QTRHQVRKGVAVRARPWRKNLQEVFGKRWLLGLLVPMFNVGSESSKQQDK
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.