ACOT11 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ACOT11
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Signal Transduction
Gene Alias
Acyl-CoA thioester hydrolase 11, acyl-CoA thioesterase 11BFIT1, Adipose-associated thioesterase, BFIT2, BFITDKFZp667O1916, Brown fat-inducible thioesterase, EC 3.1.2.-, EC 3.1.2.1, KIAA0707acyl-coenzyme A thioesterase 11, STARD14, START domain containing 14, THEAStAR-related lipid transfer (START) domain containing 14, THEM1, thioesterase superfamily member 1, thioesterase, adipose associated
Gene Symbols
ACOT11
Isotype
IgG
Purification Method
Affinity Purified
Applications
Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene ID (Entrez)
26027
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGE
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- ACOT11 Polyclonal specifically detects ACOT11 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: ACOT11
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Signal Transduction
Gene Alias: Acyl-CoA thioester hydrolase 11, acyl-CoA thioesterase 11BFIT1, Adipose-associated thioesterase, BFIT2, BFITDKFZp667O1916, Brown fat-inducible thioesterase, EC 3.1.2.-, EC 3.1.2.1, KIAA0707acyl-coenzyme A thioesterase 11, STARD14, START domain containing 14, THEAStAR-related lipid transfer (START) domain containing 14, THEM1, thioesterase superfamily member 1, thioesterase, adipose associated
Gene Symbols: ACOT11
Isotype: IgG
Purification Method: Affinity Purified
Applications: Western Blot, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 26027
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:FLLLSDLRQRPEWDKHYRSVELVQQVDEDDAIYHVTSPALGGHTKPQDFVILASRRKPCDNGDPYVIALRSVTLPTHRETPEYRRGE
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: ARHGEF33
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: Rho guanine nucleotide exchange factor (GEF) 33
Gene Symbols: ARHGEF33
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 100271715
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSPFRSINIPEPVLPSEDFTNLLPSQAYEKAQESRSVHVGDSNVKGMMGPGVNPTTPEAEENLK
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: ARHGEF33
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: Rho guanine nucleotide exchange factor (GEF) 33
Gene Symbols: ARHGEF33
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunohistochemistry, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 100271715
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GSPFRSINIPEPVLPSEDFTNLLPSQAYEKAQESRSVHVGDSNVKGMMGPGVNPTTPEAEENLK
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.