SIRP alpha/CD172a Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
SIRP alpha/CD172a
Applications
Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene ID (Entrez)
140885
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution
Immunohistochemistry-Paraffin 1:50 - 1:200
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
GPCR, Protein Phosphatase, Signal Transduction
Gene Alias
Bit, BITbrain-immunoglobulin-like molecule with tyrosine-based activation motifs, Brain Ig-like molecule with tyrosine-based activation motifs, CD172 antigen-like family member A, CD172a, CD172a antigen, Inhibitory receptor SHPS-1, Macrophage fusion receptor, MFRtyrosine phosphatase SHP substrate 1, MYD1, MYD-1, MyD-1 antigen, P84, protein tyrosine phosphatase, non-receptor type substrate 1, PTPNS1, SHP substrate 1, SHPS-1, SHPS1CD172A, signal-regulatory protein alpha, Signal-regulatory protein alpha-1, Signal-regulatory protein alpha-2, Signal-regulatory protein alpha-3, SIRPalpha, SIRP-ALPHA-1, Sirp-alpha-2, SIRPalpha2, Sirp-alpha-3, SIRPtyrosine-protein phosphatase non-receptor type substrate 1
Gene Symbols
SIRPA
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- SIRP alpha/CD172a Polyclonal specifically detects SIRP alpha/CD172a in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: SIRP alpha/CD172a
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 140885
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NNHTEYASIQTSPQPASEDTLTYADLDMVHLNRTPKQPAPKPEPSFSEYASVQVPRK
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Immunohistochemistry-Paraffin 1:50 - 1:200
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: GPCR, Protein Phosphatase, Signal Transduction
Gene Alias: Bit, BITbrain-immunoglobulin-like molecule with tyrosine-based activation motifs, Brain Ig-like molecule with tyrosine-based activation motifs, CD172 antigen-like family member A, CD172a, CD172a antigen, Inhibitory receptor SHPS-1, Macrophage fusion receptor, MFRtyrosine phosphatase SHP substrate 1, MYD1, MYD-1, MyD-1 antigen, P84, protein tyrosine phosphatase, non-receptor type substrate 1, PTPNS1, SHP substrate 1, SHPS-1, SHPS1CD172A, signal-regulatory protein alpha, Signal-regulatory protein alpha-1, Signal-regulatory protein alpha-2, Signal-regulatory protein alpha-3, SIRPalpha, SIRP-ALPHA-1, Sirp-alpha-2, SIRPalpha2, Sirp-alpha-3, SIRPtyrosine-protein phosphatase non-receptor type substrate 1
Gene Symbols: SIRPA
Isotype: IgG
Purification Method: Affinity Purified
Antigen: FAM69B
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 138311
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EELGTQLRTCTTLSGLASQVEAHHSLVLSHLKTLLWK
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: __
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: C9orf136, FAM69B family with sequence similarity 69, member B, pp6977
Gene Symbols: FAM69B
Isotype: IgG
Purification Method: Affinity Purified
Antigen: FOXRED1
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 55572
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LSVGGIRQQFSLPENIQLSLFSASFLRNINEYLAVVDAPPLDLRFNPSGYLLLASEKDAAAMESNVKVQRQEGAKVSLMSPDQLRNK
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: __
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: FAD-dependent oxidoreductase domain containing 1, FAD-dependent oxidoreductase domain-containing protein 1, H17
Gene Symbols: FOXRED1
Isotype: IgG
Purification Method: Affinity Purified