ATM Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ATM
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Apoptosis, Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, Chromatin Research, DNA Double Strand Break Repair, DNA Repair, Genes Sensitive to DNA Damaging Agents, Hypoxia, Modulation of DNA Pools, p53 Pathway, Tumor Suppressors
Gene Alias
AT mutated, A-T mutated, AT1, ATA, ataxia telangiectasia mutated (includes complementation groups A, C and D), ataxia telangiectasia mutatedATD, ATC, ATDC, ATE, DKFZp781A0353, EC 2.7.11.1, MGC74674, serine-protein kinase ATM, TEL1, TEL1, telomere maintenance 1, homolog, TELO1
Gene Symbols
ATM
Isotype
IgG
Purification Method
Affinity Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene ID (Entrez)
472
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHPTLNADDQECKRNLSDIDQSFNKVAERVLMRLQEKLKGVE
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- ATM Polyclonal specifically detects ATM in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ATM
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Apoptosis, Breast Cancer, Cancer, Cell Cycle and Replication, Checkpoint signaling, Chromatin Research, DNA Double Strand Break Repair, DNA Repair, Genes Sensitive to DNA Damaging Agents, Hypoxia, Modulation of DNA Pools, p53 Pathway, Tumor Suppressors
Gene Alias: AT mutated, A-T mutated, AT1, ATA, ataxia telangiectasia mutated (includes complementation groups A, C and D), ataxia telangiectasia mutatedATD, ATC, ATDC, ATE, DKFZp781A0353, EC 2.7.11.1, MGC74674, serine-protein kinase ATM, TEL1, TEL1, telomere maintenance 1, homolog, TELO1
Gene Symbols: ATM
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 472
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LTIVEVLLYDPLFDWTMNPLKALYLQQRPEDETELHPTLNADDQECKRNLSDIDQSFNKVAERVLMRLQEKLKGVE
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: HYDIN1
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: CILD5, HYDIN, Axonemal Central Pair Apparatus Protein, HYDIN2, Hydrocephalus Inducing, Hydrocephalus Inducing Homolog (Mouse), Hydrocephalus-Inducing Protein Homolog, KIAA1864, PPP1R31, Protein Phosphatase 1, Protein Phosphatase 1, Regulatory Subunit 31, Regulatory Subunit 31
Gene Symbols: HYDIN
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 54768
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YLPGVPEVFKRSFQIQIAHLDPENITLSGEGIFPQICLDLPRNLTANEKYEMFLNQARKNTDKEYNKCEMLDHFDVITEEVPEDEPAEVSAHLQ
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: PABP
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Core ESC Like Genes, DNA Repair, DNA replication Transcription Translation and Splicing, Stem Cell Markers
Gene Alias: PAB1polyadenylate-binding protein 1, PABP, PABP-1, PABP1poly(A) binding protein, cytoplasmic 2, PABPC2, PABPL1, poly(A) binding protein, cytoplasmic 1, Poly(A)-binding protein 1, poly(A)-binding protein, cytoplasmic 2
Gene Symbols: PABPC1
Isotype: IgG
Purification Method: Affinity Purified
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 26986
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QTQNRAAYYPPSQIAQLRPSPRWTAQG
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
