AGPAT1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
AGPAT1
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene ID (Entrez)
10554
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Western Blot, Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
1-acylglycerol-3-phosphate O-acyltransferase 1, 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme Athiolase), 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acidacyltransferase, alpha), 1-AGP acyltransferase 1, 1-AGPAT1, EC 2.3.1.51, G15, LPAATA, LPAAT-alpha1-acyl-sn-glycerol-3-phosphate acyltransferase alpha, Lysophosphatidic acid acyltransferase alpha, lysophospholipid acyltransferase, MGC4007,1-AGPAT 1, MGC5423, Protein G15
Gene Symbols
AGPAT1
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- AGPAT1 Polyclonal specifically detects AGPAT1 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: AGPAT1
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 10554
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GQCQVRVLPPVPTEGLTPDDVPALADRVRHSMLTVFREISTDGRGGGDYLKKPG
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Western Blot, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: 1-acylglycerol-3-phosphate O-acyltransferase 1, 1-acylglycerol-3-phosphate O-acyltransferase 1 (acetoacetly Coenzyme Athiolase), 1-acylglycerol-3-phosphate O-acyltransferase 1 (lysophosphatidic acidacyltransferase, alpha), 1-AGP acyltransferase 1, 1-AGPAT1, EC 2.3.1.51, G15, LPAATA, LPAAT-alpha1-acyl-sn-glycerol-3-phosphate acyltransferase alpha, Lysophosphatidic acid acyltransferase alpha, lysophospholipid acyltransferase, MGC4007,1-AGPAT 1, MGC5423, Protein G15
Gene Symbols: AGPAT1
Isotype: IgG
Purification Method: Affinity Purified
Antigen: FOXB1
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 27023
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PIKPTPAAVPALPALPAPIPTLLSNSPPSLSPTSSQTATSQSSPATPSETLTSPASALHSVAVH
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: FKH5HFKH-5, forkhead box B1, forkhead box protein B1, Transcription factor FKH-5
Gene Symbols: FOXB1
Isotype: IgG
Purification Method: Affinity Purified
Antigen: TNFAIP8
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 25816
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:MHSEAEESKEVATDVFNSKNLAVQAQ
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: GG2-1, Head and neck tumor and metastasis-related protein, MDC-3.13TNF-induced protein GG2-1, NDED, NF-kappa-B-inducible DED-containing protein, SCC-S2SCCS2, TNF alpha-induced protein 8, tumor necrosis factor alpha-induced protein 8, tumor necrosis factor, alpha-induced protein 8
Gene Symbols: TNFAIP8
Isotype: IgG
Purification Method: Affinity Purified
