IDH3B Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
IDH3B
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene ID (Entrez)
3420
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
EC 1.1.1, EC 1.1.1.41, FLJ11043, H-IDHB, isocitrate dehydrogenase [NAD] subunit beta, mitochondrial, isocitrate dehydrogenase 3 (NAD+) beta, isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, beta subunit, Isocitric dehydrogenase subunit beta, MGC903, NAD(+)-specific ICDH subunit beta, NAD+-specific ICDH, NAD+-specific isocitrate dehydrogenase b subunit, NAD+-specific isocitrate dehydrogenase beta, RP46
Gene Symbols
IDH3B
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- IDH3B Polyclonal specifically detects IDH3B in Human samples
- It is validated for Western Blot, Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: IDH3B
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 3420
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TAMLLSASNMLRHLNLEYHSSMIADAVKKVIKVGKVRTRDMGGYSTTTDFIKSVIGHLQTKGS
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: EC 1.1.1, EC 1.1.1.41, FLJ11043, H-IDHB, isocitrate dehydrogenase [NAD] subunit beta, mitochondrial, isocitrate dehydrogenase 3 (NAD+) beta, isocitrate dehydrogenase, NAD(+)-specific, mitochondrial, beta subunit, Isocitric dehydrogenase subunit beta, MGC903, NAD(+)-specific ICDH subunit beta, NAD+-specific ICDH, NAD+-specific isocitrate dehydrogenase b subunit, NAD+-specific isocitrate dehydrogenase beta, RP46
Gene Symbols: IDH3B
Isotype: IgG
Purification Method: Affinity Purified
Antigen: SFXN5
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 94097
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RLREAVQLLEDYKHGTLRPGVTNEQLWSAQKIKQAILHPDTNEKIFMPFRMS
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: BBG-TCC, sideroflexin 5
Gene Symbols: SFXN5
Isotype: IgG
Purification Method: Affinity Purified
Antigen: SFXN5
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 94097
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RLREAVQLLEDYKHGTLRPGVTNEQLWSAQKIKQAILHPDTNEKIFMPFRMS
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: BBG-TCC, sideroflexin 5
Gene Symbols: SFXN5
Isotype: IgG
Purification Method: Affinity Purified
