CDKN3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
CDKN3
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Cell Cycle and Replication, Core ESC Like Genes, Protein Phosphatase, Stem Cell Markers
Gene Alias
CDI1KAP1, CDK2-associated dual specificity phosphatase, CDK2-associated dual-specificity phosphatase, Cdk-associated protein phosphatase, CIP2, cyclin-dependent kinase inhibitor 3, cyclin-dependent kinase interacting protein 2, Cyclin-dependent kinase interactor 1, Cyclin-dependent kinase-interacting protein 2, EC 3.1.3.16, EC 3.1.3.48, FLJ25787, KAPMGC70625, Kinase-associated phosphatase
Gene Symbols
CDKN3
Isotype
IgG
Purification Method
Affinity Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene ID (Entrez)
1033
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- CDKN3 Polyclonal specifically detects CDKN3 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: CDKN3
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Cell Cycle and Replication, Core ESC Like Genes, Protein Phosphatase, Stem Cell Markers
Gene Alias: CDI1KAP1, CDK2-associated dual specificity phosphatase, CDK2-associated dual-specificity phosphatase, Cdk-associated protein phosphatase, CIP2, cyclin-dependent kinase inhibitor 3, cyclin-dependent kinase interacting protein 2, Cyclin-dependent kinase interactor 1, Cyclin-dependent kinase-interacting protein 2, EC 3.1.3.16, EC 3.1.3.48, FLJ25787, KAPMGC70625, Kinase-associated phosphatase
Gene Symbols: CDKN3
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 1033
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TISPEQAIDSLRDLRGSGAIQTIKQYNYLHEFRDKLAAHLSSRDSQSRSVSR
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: Plakophilin 2
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: ARVD9, MGC177501, plakophilin 2, plakophilin-2
Gene Symbols: PKP2
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunohistochemistry, Immunocytochemistry, Immunofluorescence, Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 5318
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NLLTERSTFTDSQLGNADMEMTLERAVSMLEADHMLPSRISAAATFIQHECFQKSEARKRVNQLRGILKLLQLLKVQNEDVQRAVC
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: DNAJC22
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: DnaJ (Hsp40) homolog, subfamily C, member 22, dnaJ homolog subfamily C member 22, FLJ13236, wurst homolog, wus
Gene Symbols: DNAJC22
Isotype: IgG
Purification Method: Affinity Purified
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 79962
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:GETGFNSSCFQEWAKLYEFVHSFQDEKRQLAYQVLGLSEGATNEEIHRSYQELVKVWHPDHNLDQTEEAQRHFLEIQAAYEVLSQPRKP
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
