OVCA1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
OVCA1
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene ID (Entrez)
1801
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAK
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
Diphthamide biosynthesis protein 2 homolog-like 1, Diphthamide biosynthesis protein 2-like, diptheria toxin resistance protein required for diphthamide biosynthesis(Saccharomyces)-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1(S. cerevisiae), DPH1 homolog, DPH1 homolog (S. cerevisiae), DPH2L, DPH2L1diphthamide biosynthesis protein 1, DPH2-like 1, DPH-like 1, DPH-like 1 (S. cerevisiae), FLJ33211, hsDph1, Ovarian cancer-associated gene 1 protein, ovarian tumor suppressor candidate 1, OVCA1candidate tumor suppressor in ovarian cancer 1
Gene Symbols
DPH1
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- OVCA1 Polyclonal specifically detects OVCA1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: OVCA1
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 1801
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EAVVYLGDGRFHLESVMIANPNVPAYRYDPYSKVLSREHYDHQRMQAARQEAIATARSAK
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: Diphthamide biosynthesis protein 2 homolog-like 1, Diphthamide biosynthesis protein 2-like, diptheria toxin resistance protein required for diphthamide biosynthesis(Saccharomyces)-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1, diptheria toxin resistance protein required for diphthamide biosynthesis-like 1(S. cerevisiae), DPH1 homolog, DPH1 homolog (S. cerevisiae), DPH2L, DPH2L1diphthamide biosynthesis protein 1, DPH2-like 1, DPH-like 1, DPH-like 1 (S. cerevisiae), FLJ33211, hsDph1, Ovarian cancer-associated gene 1 protein, ovarian tumor suppressor candidate 1, OVCA1candidate tumor suppressor in ovarian cancer 1
Gene Symbols: DPH1
Isotype: IgG
Purification Method: Affinity Purified
Antigen: TMEM48
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 55706
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VITQGQYSFLVVPCTGTNSFGSPAAQTCLNEY
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: FLJ10407, FLJ34120, NDC1, NET3, transmembrane protein 48
Gene Symbols: NDC1
Isotype: IgG
Purification Method: Affinity Purified
Antigen: TCERG1
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 10915
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:HPTPTMLSIQKWQFSMSAIKEEQELMEEINEDEPVKAKKRKRDDNKDIDSEKEAAMEAEIKAARERAIVPLE
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: CA150TATA box-binding protein-associated factor 2S, co-activator of 150 kDa, TAF2SMGC133200, TATA box binding protein (TBP)-associated factor, RNA polymerase II, S, 150kD, TATA box-binding protein-associated factor 2S, transcription elongation regulator 1, Transcription factor CA150, Urn1
Gene Symbols: TCERG1
Isotype: IgG
Purification Method: Affinity Purified
