TRUSS Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
TRUSS
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene ID (Entrez)
26133
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESSFRFWQARAVESFLRGTTSYADQMFLLKRGLLEHILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINS
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Gene Alias
C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, Protein TAP1, Protein TRUSS, short transient receptor potential channel 4 associated protein, short transient receptor potential channel 4-associated protein, TNF-receptor ubiquitous scaffolding/signaling protein, transient receptor potential cation channel, subfamily C, member 4 associatedprotein, Trp4-associated protein, Trpc4-associated protein, TRRP4APchromosome 20 open reading frame 188, TRUSS, tumor necrosis factor receptor-associated ubiquitous scaffolding and signalingprotein
Gene Symbols
TRPC4AP
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- TRUSS Polyclonal specifically detects TRUSS in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: TRUSS
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 26133
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ESSFRFWQARAVESFLRGTTSYADQMFLLKRGLLEHILYCIVDSECKSRDVLQSYFDLLGELMKFNVDAFKRFNKYINTDAKFQVFLKQINS
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: C20orf188, dJ756N5.2, DKFZp586C1223, DKFZP727M231, Protein TAP1, Protein TRUSS, short transient receptor potential channel 4 associated protein, short transient receptor potential channel 4-associated protein, TNF-receptor ubiquitous scaffolding/signaling protein, transient receptor potential cation channel, subfamily C, member 4 associatedprotein, Trp4-associated protein, Trpc4-associated protein, TRRP4APchromosome 20 open reading frame 188, TRUSS, tumor necrosis factor receptor-associated ubiquitous scaffolding and signalingprotein
Gene Symbols: TRPC4AP
Isotype: IgG
Purification Method: Affinity Purified
Antigen: XPC
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 7508
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:RALGNWKLLAKGLLIRERLKRRYGPKSEAAAPHTDAGGGLSSDEEEGTSSQAEAARILAASWPQNREDEEKQKLKGGPKKTKREKKAAASHLFPFEQ
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: complementation group C p125, RAD4, Xeroderma pigmentosum group C-complementing protein, xeroderma pigmentosum, complementation group C, XP3, XPCCDNA repair protein complementing XP-C cells
Gene Symbols: XPC
Isotype: IgG
Purification Method: Affinity Purified
Antigen: ATP2C1
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene ID (Entrez): 27032
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TKNEMTVTHIFTSDGLHAEVTGVGYNQFGEVIVDGDVVHGFYNPAVSRIVEAGCVCNDAVIRNNTLMGKPTE
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Gene Alias: ATPase, Ca++ transporting, type 2C, member 1, BCPM, benign chronic pemphigus (Hailey-Hailey disease), Ca(2+)-sequestering, calcium-transporting ATPase type 2C member 1, EC 3.6.3, HHD, hSPCA1, HUSSY-28, PMR1L, secretory pathway Ca2+/Mn2+ ATPase 1
Gene Symbols: ATP2C1
Isotype: IgG
Purification Method: Affinity Purified
