POMC Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
POMC
Applications
Immunohistochemistry (Paraffin)
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene ID (Entrez)
5443
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPLTENPRKYVMGHFRWDRFG
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution
Immunohistochemistry-Paraffin 1:5000 - 1:10000
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Neuroscience, Nutrient Sensing in the Brain
Gene Alias
ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene Symbols
POMC
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- POMC Polyclonal specifically detects POMC in Human samples
- It is validated for Immunohistochemistry, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: POMC
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 5443
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SQCQDLTTESNLLECIRACKPDLSAETPMFPGNGDEQPLTENPRKYVMGHFRWDRFG
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Immunohistochemistry-Paraffin 1:5000 - 1:10000
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Neuroscience, Nutrient Sensing in the Brain
Gene Alias: ACTH, adrenocorticotropic hormone, adrenocorticotropin, alpha-melanocyte-stimulating hormone, alpha-MSH, beta-endorphin, beta-LPH, beta-melanocyte-stimulating hormone, beta-MSH, CLIP, corticotropin-like intermediary peptide, corticotropin-lipotropin, gamma-LPH, gamma-MSH, lipotropin beta, lipotropin gamma, LPH, melanotropin alpha, melanotropin beta, melanotropin gamma, met-enkephalin, MSH, NPP, POC, pro-ACTH-endorphin, proopiomelanocortin, pro-opiomelanocortin, proopiomelanocortin preproprotein
Gene Symbols: POMC
Isotype: IgG
Purification Method: Affinity Purified
Antigen: FSH beta
Applications: Immunohistochemistry (Paraffin)
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 2488
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:TRDLVYKDPARPKIQKTCTFKELVYETVRVPGCAHHADSLYTYPVATQCHCGK
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: Immunohistochemistry-Paraffin 1:20 - 1:50
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Cancer
Gene Alias: follicle stimulating hormone, beta polypeptide, Follicle-stimulating hormone beta subunit, Follitropin beta chain, follitropin subunit beta, follitropin, beta chain, FSH-B, FSH-beta
Gene Symbols: FSHB
Isotype: IgG
Purification Method: Affinity Purified
Antigen: C16orf55
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene ID (Entrez): 124045
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:SCSSSGSDQQRTIREPEDWGPYRRHRNPSTADAYNSHLKE
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Dilution: __
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Gene Alias: chromosome 16 open reading frame 55, FLJ31606, hypothetical protein LOC124045
Gene Symbols: C16ORF55
Isotype: IgG
Purification Method: Affinity Purified
