ST6GALNAC3 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
ST6GALNAC3
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Alias
alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3, alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase III, EC 2.4.99.-, EC 2.4.99.7, FLJ13669, FLJ27239, GalNAc alpha-2,6-sialyltransferase III, PRO7177, sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) C, Sialyltransferase 7C, SIAT7C, SIAT7-C, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltran, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 3, ST6GalNAc III, ST6GALNACIII, STY
Gene Symbols
ST6GALNAC3
Isotype
IgG
Purification Method
Affinity Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
256435
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDRVQSGS
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- ST6GALNAC3 Polyclonal specifically detects ST6GALNAC3 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: ST6GALNAC3
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase 3, alpha-N-acetylgalactosaminide alpha-2,6-sialyltransferase III, EC 2.4.99.-, EC 2.4.99.7, FLJ13669, FLJ27239, GalNAc alpha-2,6-sialyltransferase III, PRO7177, sialyltransferase 7((alpha-N-acetylneuraminyl-2,3-beta-galactosyl-1,3)-N-acetyl galactosaminidealpha-2,6-sialyltransferase) C, Sialyltransferase 7C, SIAT7C, SIAT7-C, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltran, ST6 (alpha-N-acetyl-neuraminyl-2,3-beta-galactosyl-1,3)-N-acetylgalactosaminidealpha-2,6-sialyltransferase 3, ST6GalNAc III, ST6GALNACIII, STY
Gene Symbols: ST6GALNAC3
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 256435
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:EANTTIYVIWGPFRNMRKDGNGIVYNMLKKTVGIYPNAQIYVTTEKRMSYCDGVFKKETGKDRVQSGS
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: ZHX1
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: zona pellucida B protein, zona pellucida glycoprotein 4ZBP, Zona pellucida protein B, zona pellucida sperm-binding protein 4, Zp-4, ZPBZP1
Gene Symbols: ZHX1
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 11244
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:KEEKMEIDESNAGSSKEEAGETSPADESGAPKSGSTGKICKKTPEQLHMLKSAFVRTQWPSPEEYDKLAKESG
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: Importin4
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: IMP4B, importin 4, importin-4
Gene Symbols: IPO4
Isotype: IgG
Purification Method: Affinity Purified
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 79711
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VRDNICGALARLLMASPTRKPEPQVLAALLHALPLKEDLEEWVTIGRLFSFLYQSSPDQVIDVAPELLRICSLILADNKIPPD
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
