AF4 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
AF4
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Alias
AF-4, AF4/FMR2 family member 1, AF4/FMR2 family, member 1, AF4myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 2, ALL1-fused gene from chromosome 4 protein, FEL, MLLT2MGC134969, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 2, PBM1, pre-B-cell monocytic leukemia partner 1, Protein AF-4, Protein FEL, Proto-oncogene AF4
Gene Symbols
AFF1
Isotype
IgG
Purification Method
Affinity Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
4299
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSK
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- AF4 Polyclonal specifically detects AF4 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: AF4
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: AF-4, AF4/FMR2 family member 1, AF4/FMR2 family, member 1, AF4myeloid/lymphoid or mixed-lineage leukemia (trithorax (Drosophila) homolog);translocated to, 2, ALL1-fused gene from chromosome 4 protein, FEL, MLLT2MGC134969, myeloid/lymphoid or mixed-lineage leukemia (trithorax homolog, Drosophila);translocated to, 2, PBM1, pre-B-cell monocytic leukemia partner 1, Protein AF-4, Protein FEL, Proto-oncogene AF4
Gene Symbols: AFF1
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 4299
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VDLIKFIMSLKSFSDATAPTQEKIFAVLCMRCQSILNMAMFRCKKDIAIKYSRTLNKHFESSSK
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: FEZF1
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: FEZ, FEZ family zinc finger 1, zinc finger protein 312B, ZNF312B
Gene Symbols: FEZF1
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 389549
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:YLAERNKLVVPAVEKYPSGVAFKDLSQAQLQHYMKESAQLLSEKIAFKTSDFSRGSPNAKPKV
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: KIAA0947
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: Uncharacterized Protein KIAA0947
Gene Symbols: ICE1
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 23379
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:NKGSGTWEEKPKSHEAIQALNTWEVNKVTTSGLETFTATLRESSATHSLVGEKHWTTASRSMSDRKRDILHETKTQMEVREMDKSVQTEKTIH
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.