BTAF1 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
BTAF1
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Alias
ATP-dependent helicase BTAF1, BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa (Mot1homolog, S. cerevisiae), B-TFIID transcription factor-associated 170 kDa subunit, EC 3.6.1, EC 3.6.4.-, MOT1MGC138406, TAF(II)170KIAA0940, TAF-172, TAF172BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170 kD (Mot1homolog, S. cerevisiae), TAFII170TATA-binding protein-associated factor 172, TBP-associated factor 172
Gene Symbols
BTAF1
Isotype
IgG
Purification Method
Affinity Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
9044
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSATLS
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- BTAF1 Polyclonal specifically detects BTAF1 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: BTAF1
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: ATP-dependent helicase BTAF1, BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170kDa (Mot1homolog, S. cerevisiae), B-TFIID transcription factor-associated 170 kDa subunit, EC 3.6.1, EC 3.6.4.-, MOT1MGC138406, TAF(II)170KIAA0940, TAF-172, TAF172BTAF1 RNA polymerase II, B-TFIID transcription factor-associated, 170 kD (Mot1homolog, S. cerevisiae), TAFII170TATA-binding protein-associated factor 172, TBP-associated factor 172
Gene Symbols: BTAF1
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 9044
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:QFAARYGKPILASRDARSSSREQEAGVLAMDALHRQVLPFLLRRMKEDVLQDLPPKIIQDYYCTLSPLQVQLYEDFAKSRAKCDVDETVSSATLS
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: SPRY1
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: Drosophila, homolog of, 1 (antagonist of FGF signaling), sprouty homolog 1, antagonist of FGF signaling (Drosophila), spry-1
Gene Symbols: SPRY1
Isotype: IgG
Purification Method: Affinity Purified
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 10252
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKC
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: SPRY1
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: Drosophila, homolog of, 1 (antagonist of FGF signaling), sprouty homolog 1, antagonist of FGF signaling (Drosophila), spry-1
Gene Symbols: SPRY1
Isotype: IgG
Purification Method: Affinity Purified
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 10252
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:PTRPVPGHRSERAIRTQPKQLIVDDLKGSLKEDLTQHKFICEQCGKCKC
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.