FARP2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
FARP2
Classification
Polyclonal
Host Species
Rabbit
Target Species
Human
Gene Alias
FERM, RhoGEF and pleckstrin domain protein 2, FGD1-related Cdc42-GEF, FIRFERM domain including RhoGEF, FRG, KIAA0793PH domain-containing family C member 3, Pleckstrin homology domain-containing family C member 3, PLEKHC3FERM, RhoGEF and pleckstrin domain-containing protein 2
Gene Symbols
FARP2
Isotype
IgG
Purification Method
Affinity Purified
Applications
Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
9855
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VEESDNEWSVPHCFTIYAAQKTIVVAASTRLEKEKWMLDLNSAIQAAKSGGDTAPALPGRTVCTRPPRSPNEVSLEQESEDDARGVR
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Related Products
Description
- FARP2 Polyclonal specifically detects FARP2 in Human samples
- It is validated for Immunocytochemistry/Immunofluorescence.
Compare Similar Items
Show Difference
Antigen: FARP2
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: FERM, RhoGEF and pleckstrin domain protein 2, FGD1-related Cdc42-GEF, FIRFERM domain including RhoGEF, FRG, KIAA0793PH domain-containing family C member 3, Pleckstrin homology domain-containing family C member 3, PLEKHC3FERM, RhoGEF and pleckstrin domain-containing protein 2
Gene Symbols: FARP2
Isotype: IgG
Purification Method: Affinity Purified
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 9855
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:VEESDNEWSVPHCFTIYAAQKTIVVAASTRLEKEKWMLDLNSAIQAAKSGGDTAPALPGRTVCTRPPRSPNEVSLEQESEDDARGVR
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: Ras-GAP
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: __
Gene Symbols: RASA1
Isotype: IgG
Purification Method: Affinity Purified
Applications: __
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 5921
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQ
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Antigen: Ras-GAP
Classification: Polyclonal
Host Species: Rabbit
Target Species: Human
Gene Alias: __
Gene Symbols: RASA1
Isotype: IgG
Purification Method: Affinity Purified
Applications: __
Conjugate: Unconjugated
Regulatory Status: RUO
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 5921
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:AKEPYMEGVNPFIKSNKHRMIMFLDELGNVPELPDTTEHSRTDLSRDLAALHEICVAHSDELRTLSNERGAQQHVLKKLLAITELLQQ
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.