RUVBL2 Antibody, Novus Biologicals™
Rabbit Polyclonal Antibody
Manufacturer: Fischer Scientific
The price for this product is unavailable. Please request a quote
Antigen
RUVBL2
Classification
Polyclonal
Host Species
Rabbit
Research Discipline
Core ESC Like Genes, Stem Cell Markers
Formulation
PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez)
10856
Immunogen
This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR
Primary or Secondary
Primary
Test Specificity
Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications
Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate
Unconjugated
Regulatory Status
RUO
Target Species
Human
Gene Alias
48 kDa TATA box-binding protein-interacting protein, 51 kDa erythrocyte cytosolic protein, EC 3.6.1, EC 3.6.4.12,48 kDa TBP-interacting protein, ECP51TIP49B, erythrocyte cytosolic protein, 51-KD, INO80 complex subunit J, INO80JTAP54-beta, Repressing pontin 52, REPTIN, Reptin 52, Reptin52, RuvB (E coli homolog)-like 2, ruvB-like 2, RuvB-like 2 (E. coli), RVB2, TBP-interacting protein, 48-KD, TIH2, TIP48ECP-51, TIP49b, TIP60-associated protein 54-beta
Gene Symbols
RUVBL2
Isotype
IgG
Purification Method
Affinity Purified
Related Products
Description
- RUVBL2 Polyclonal specifically detects RUVBL2 in Human samples
- It is validated for Western Blot, Immunohistochemistry, Immunocytochemistry/Immunofluorescence, Immunohistochemistry-Paraffin.
Compare Similar Items
Show Difference
Antigen: RUVBL2
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Core ESC Like Genes, Stem Cell Markers
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 10856
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:ATVTDTTKVPEIRDVTRIERIGAHSHIRGLGLDDALEPRQASQGMVGQLAARRAAGVVLEMIREGKIAGR
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: 48 kDa TATA box-binding protein-interacting protein, 51 kDa erythrocyte cytosolic protein, EC 3.6.1, EC 3.6.4.12,48 kDa TBP-interacting protein, ECP51TIP49B, erythrocyte cytosolic protein, 51-KD, INO80 complex subunit J, INO80JTAP54-beta, Repressing pontin 52, REPTIN, Reptin 52, Reptin52, RuvB (E coli homolog)-like 2, ruvB-like 2, RuvB-like 2 (E. coli), RVB2, TBP-interacting protein, 48-KD, TIH2, TIP48ECP-51, TIP49b, TIP60-associated protein 54-beta
Gene Symbols: RUVBL2
Isotype: IgG
Purification Method: Affinity Purified
Antigen: DGCR2
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: __
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 9993
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:('IHPDSVFYDPADDDAFEPVEVSLPAPGDGGSEGALLRRLEQPLPTAGASLADLEDSADSSSALLVPPDPAQSGSTPAAEALPGGGRHSRSSLNTV',)
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: DGS-C, DiGeorge syndrome critical region gene 2, IDDDKFZp686I1730, integral membrane protein deleted in DiGeorge syndrome, integral membrane protein DGCR2/IDD, KIAA0163DiGeorge syndrome critical region protein 2, LAN, SEZ-12
Gene Symbols: DGCR2
Isotype: IgG
Purification Method: Affinity Purified
Antigen: TFG
Classification: Polyclonal
Host Species: Rabbit
Research Discipline: Signal Transduction
Formulation: PBS, pH 7.2, containing 40% glycerol with 0.02% Sodium Azide
Gene ID (Entrez): 10342
Immunogen: This antibody was developed against a recombinant protein corresponding to the following amino acid sequence:LRRELIELRNKVNRLLDSLEPPGEPGPSTNIPENDTVDGREEKSASDSSGKQSTQVMAASMSAFDPLKNQDEINKNVMSAFGLTDDQVSGPPS
Primary or Secondary: Primary
Test Specificity: Specificity of antibody verified on a Protein Array containing target protein plus 383 other non-specific proteins.
Applications: Western Blot, Immunocytochemistry, Immunofluorescence
Conjugate: Unconjugated
Regulatory Status: RUO
Target Species: Human
Gene Alias: FLJ36137, protein TFG, TF6, TRK-fused gene, TRK-fused gene protein, TRKT3, TRKT3 oncogene
Gene Symbols: TFG
Isotype: IgG
Purification Method: Affinity Purified
